KEGG   Micromonas sp. RCC299: MICPUN_55966Help
Entry
MICPUN_55966      CDS       T02695                                 

Gene name
AMY3
Definition
glycoside hydrolase family 13 protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUN_55966 (AMY3)
Enzymes [BR:mis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MICPUN_55966 (AMY3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1181607..1183310)
Genome map
AA seq 567 aa AA seqDB search
MARGIPCLNPRCIQHGTNLGSPRRHARGVRTTGAPKRVRKSPPPSSSMGNSPSRPGSPSL
AGPRAGTPTRLRYDVSTGVATDDAPALAPDQTPSASADPFSENYASVMLQGFHWRSCNAR
ELGLTADRSWYGEVLANIPALVQTGVDAVWLPPPSHSVSPEGYLPQRLYDLDSRYGTKEE
LKTLCRELKAAGIKPMADIVINHRCADTQDENGAWRIFSNVSFPPTDDVEPGKSFDRTWG
PWAIVKDDPVFHGEGNSDTGESFPPAPDLDHANDRVRRELTAWLNWLKNSVGFVGWRFDY
AKGYGASFVKEYVDNTVGAGAMNVAEFWPEASWEPDGRLALDQNPMRQSMCDWLDRAKAS
TAAFDFATKAVLQEAVAKNELWRLRDADGKPPGLIGWWPQRAVTFVDNHDTGGTGQAAGS
DSGRMKDGSDFIGGGSYGQGHWRFPPEHRMCGYAYILTHPGIPCLFWPHAVRMPDGRHGD
MAAEVAAMVRMRKDAGIAADSRVDILVAESDVYVARVRGRHADVTVKLGPRYDFPAEIMP
TEGGREWKMCASGKDYAIWSRPHATRA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcggcatcccgtgcctgaacccccggtgcatccaacacggaaccaacctcggt
tctccccgacgacacgcccggggcgttcgcacgaccggcgcccctaaacgcgtcagaaaa
tcccctcccccctcctcctccatgggcaactcgccgtcccgtcccggatctccgtccctc
gcgggtcctcgggcgggcacgcccacgcgccttcggtacgatgtctccaccggcgtggcc
accgacgacgcccccgcgctcgcccccgaccaaaccccctccgcgtccgccgatccgttc
agcgagaactacgcgtcggtgatgctgcagggcttccactggcgcagctgcaacgccagg
gaactgggcctgaccgcggaccgcagctggtacggggaggtcctcgcgaacattcccgcg
ctggtgcagaccggcgtcgacgccgtctggctcccgccgccgtcgcactccgtctctccg
gagggatacctgccccagaggctctacgacctcgacagccggtacggcacaaaagaggaa
ctcaagacgctgtgtcgcgagctcaaagccgcggggatcaaaccgatggcggatatcgtc
atcaaccacaggtgcgcggacacccaggacgagaacggcgcctggaggatcttcagcaac
gtgtcgttcccgccaaccgacgacgtggagcccgggaagagcttcgacaggacgtgggga
ccgtgggccatcgtcaaggacgatcccgtgtttcacggcgagggtaacagcgacacgggc
gagtcgttcccgcccgcgccggacctggaccacgccaacgaccgcgtgcggcgcgagctc
accgcgtggctcaactggctcaaaaactccgtcgggttcgtcgggtggaggttcgattac
gctaaaggatacggcgcttcgttcgtgaaggagtacgtggacaacaccgtgggggcgggg
gcgatgaacgtcgccgagttttggcccgaggcgagctgggagcccgacggacggctcgcg
ttggatcagaacccgatgcggcagagcatgtgcgactggctggaccgcgcgaaagcgtcc
acggcggcgtttgattttgccaccaaggcggtgctgcaggaggcggttgccaaaaacgag
ctctggcgcctgagggacgcggacggcaagccgccggggctgatcggctggtggccccag
cgcgcggtcaccttcgtggacaaccacgacaccggcgggaccggtcaggcggcgggttcc
gactcgggcaggatgaaggacggcagcgatttcatcggcggcggttcctacgggcaaggg
cactggcgattcccccccgaacacaggatgtgtggttacgcatatatactgacgcacccg
gggatcccgtgcctgttttggccgcacgcggtgcgcatgccggacggcaggcacggggat
atggcggcggaggtggccgccatggtccggatgcgaaaggacgcgggcatcgccgccgac
tcgagggtcgacatcctcgtcgccgagtcggacgtgtacgtggcgagggtgaggggccgc
cacgccgacgtgacggtgaagctcggcccgaggtacgactttccggcggagatcatgcca
acggagggggggcgggagtggaagatgtgcgcaagcggtaaggactacgcgatctggtcg
cggccgcacgcgacgcgggcatga

DBGET integrated database retrieval system