KEGG   Micromonas sp. RCC299: MICPUN_57468Help
Entry
MICPUN_57468      CDS       T02695                                 

Definition
histone deacetylase, SIR2 family
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     MICPUN_57468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:1739925..1740863
Genome map
AA seq 312 aa AA seqDB search
MAGTSLGYAERLSWRDDVGGTLGDPELSEPDADDLERKIDRLAELFRDAKEGVVVHTGAG
ISTSAGIPDFRGPKGVWTLQKKGEPIPPAKCSFDRARPTPTHMALVELQRAGFVRYLVSC
NVDCLHIRSGFPRDRLAELHGNCFAERCDACGSEYIRDFEMPSVGFKPTGRRCVAVKGKR
RCSGQLRDQVLDWDDALPPKELRAAERHSREASLSLVLGSSLQIIPSCNLPLKTVRGGKG
KLAIVNLQKTGKDKKADVVIHEKTDIVMAGLMRRLGLAIPEYVHSDTKRQWDKTFRPLKV
DEEDSAKRARVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcacgtccctgggctacgccgagagactgagctggagggacgatgtagggggt
actctcggcgaccccgaactctccgaacccgacgcagatgatctggagcgaaagatcgac
cgcctcgctgagctcttccgcgacgcgaaggaaggggtggtggtgcacacgggagccggg
atctcaacttcagcagggatacccgacttccgcggacccaagggggtgtggaccctgcag
aagaagggcgagcccatcccgcccgcgaagtgcagtttcgaccgcgccagaccaacccct
acgcacatggcgctggtcgagctgcagcgagcggggttcgtgaggtatctcgtgtcctgc
aacgtagattgccttcacataaggtcgggctttcctagggaccgcctggccgagttgcac
gggaattgtttcgctgagaggtgcgacgcgtgcgggagcgagtacattcgtgactttgag
atgccttcggtgggcttcaaacccacggggaggcggtgcgtggcggtgaagggaaagcgt
cgatgttctggtcagctcagggaccaggttctcgattgggacgacgcgttacctccgaag
gaactcagggccgcggagcgtcactcgcgcgaggcgtcgctgtccctcgtgctcgggtca
tctctccagatcattcctagctgcaacctgcccctcaagacggtccggggcgggaaaggt
aagctcgccatcgtcaacctgcagaagacgggcaaggacaaaaaagccgacgtcgtgatc
cacgaaaagacggacatcgtcatggcgggtttgatgcggcggctgggtttggcgataccc
gagtacgtgcactcggacacgaagagacagtgggacaagaccttccgccccttgaaggtt
gacgaagaggatagtgcgaagcgagcgcgcgtgaagtag

DBGET integrated database retrieval system