KEGG   Micromonas sp. RCC299: MICPUN_57888Help
Entry
MICPUN_57888      CDS       T02695                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUN_57888
Transcription machinery [BR:mis03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MICPUN_57888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:852400..853869
Genome map
AA seq 489 aa AA seqDB search
MRHKARAQANTLAGGFNWLCPEEKPTLGPPKGTESTADRAAVGARTAKGGGMDLIRNFLG
GGNNGEEPDAKRVKREDDDSAGAANGGANGTSTSGAGGAGGAGVEGKVDHLGQYAMREIH
LRKQEEDGELVYMVIKNDGEEQNMIWLVNLKNIFSKQLPNMPKEYIVRLVMDPRHHSMIC
LKNNTVIGGITYRPFWRQNMGEIAFCAVSANEQVKGYGTRLMNHLKEYVCDKENMTHLIT
FADNNAVGYFQKQGFTKDVMMEREKWVGYIKEYDGGTIMECALSAQVSYTEFPVMIRQQR
AAVDEKVREMSNSHVVYPGLAQFKGPAGPGGVRKPVPPEVIKGIKEAGWEPPGPPRYRLV
HPGCGDGTPTTDNLHRFMVALVNLVQNHIDSWPFISPVPAEEVPDYYDVVKDPICLETIK
ERVESGEYYQTLEMFAADFRLMFNNCRLYNAPDTVFYKNATRLEAYFESKVAAGISWKAG
RGERSLDRF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagacacaaggcgagagcacaagcaaacacactggcgggagggttcaattggctttgc
cctgaagaaaaacccacccttggcccccccaaagggacagaaagcaccgcagatcgcgct
gccgtgggggcgcggactgcgaaaggcggcggcatggatctcattcgaaacttcctggga
ggtgggaacaacggcgaggagcccgatgcgaagcgcgtgaagcgagaggacgacgacagc
gccggcgccgcgaacggaggggcgaatggcacgtccacgagcggcgcgggcggcgcggga
ggggcgggggtggagggaaaggtggaccacctcggccagtacgccatgcgggagatacat
ttgcgcaagcaggaggaggacggtgaactcgtgtacatggtcatcaagaacgacggcgag
gagcagaacatgatctggctcgtcaacctaaagaacatcttcagcaagcagctccctaac
atgccaaaggagtacatcgtgcgcctggtgatggacccaaggcaccactccatgatctgt
ttgaagaataacaccgtaattggcggcatcacgtacaggccgttctggaggcagaacatg
ggagagattgcgttctgcgcagtgagcgccaacgagcaggtgaagggctacggcacccgg
ctgatgaaccacctgaaggagtacgtgtgcgacaaggagaacatgacgcacctcatcacg
ttcgcggacaacaacgcggtgggatactttcagaagcagggcttcaccaaggacgtcatg
atggagcgcgagaaatgggtcggctacatcaaggagtacgacggcggcaccatcatggag
tgcgccctctctgcgcaggtttcgtacacagagttcccggtgatgatccggcagcagcgc
gcggcggtggacgaaaaggtgagggaaatgtccaactcgcacgtggtgtaccccggtctg
gcgcagttcaagggacccgcgggaccgggcggcgtgcgcaaacctgtgcccccagaggtc
atcaagggtataaaggaagctggctgggagccgccgggcccgcccaggtaccggctcgtc
cacccgggctgcggcgacggcacgcccacgaccgataatcttcacaggttcatggtggcg
ctagtgaatctggtgcagaaccacatagactcgtggcccttcatatcgccggtgcctgcg
gaggaggtgccggactactacgacgtggtcaaggatcccatctgcctggagacaatcaag
gagcgggtggagagcggggagtactaccagaccctcgagatgttcgctgcggacttcaga
ctgatgttcaacaactgcaggctgtacaacgcgccggacactgtgttctacaagaacgcc
acgcggctcgaggcgtactttgagtcgaaggtggcagcgggaatttcctggaaagctggc
aggggcgaacggtcgcttgaccggttctga

DBGET integrated database retrieval system