KEGG   Micromonas sp. RCC299: MICPUN_59858Help
Entry
MICPUN_59858      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mis  Micromonas sp. RCC299
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MICPUN_59858
Enzymes [BR:mis01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MICPUN_59858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(313343..315061)
Genome map
AA seq 572 aa AA seqDB search
MGVIRLLALAAFVAYSRGDLWDVTGHDSARETAADEHYRGDLRIAFGSCNRHDRAQDLWP
AVRSLSADAWVWLGDAIYADGKVDNVRRYGGRAFHRDAYATQNEHPEYAALRAETRILGT
WDDHDYGFNNAGAEWREKEFAQRLFLDFLGEPLGSPRRTRAGVYEAYTFRGLGASQTGSA
RLILLDARFHASAKDGTLLGDEQWEWFERLMLGRRTGAEGAEGGAEGAEDYYDGDDEGRP
SSEPRGGCVVFDGAEMNENTDCDPVDVTIVGSSVQVHAHTQELLAKMGIGMDIESWNDYP
AERRRLFDLVAAANVRTRAVVLSGDVHHSEIGGSPAGCDLPSELVEITSSGMTHGVLEEL
PTKFLRRLARHSTWGMEYLPPWLFPDVGNLRRRRYVGYNFGEVVVDFGVDWDGDAEGGAE
GGVDDDAFDAAVDASPPANRSPASERDFLRDDVSSSSSSSSSSSRVGRAPRAAAREPTVS
LRIRGVDGGVKLSKTVPFSALEGEWAEYGARGASVSRSRAECRGESSLTAAQTWRLPVML
VGVALAGPAGTSLALWWLWREVGRVRRKRKAD
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatccggctcctggcgctcgccgcgttcgtcgcgtactcgcgcggggacttg
tgggacgtcacaggccacgacagcgcgcgagaaaccgccgcggacgagcactaccgcggc
gacttgcgcatcgccttcggctcgtgcaaccgccacgaccgcgcgcaggacctgtggccc
gcggtccgttccctctccgcggacgcttgggtgtggctcggcgacgccatctacgccgac
ggcaaggtcgataacgtccggcgctacggaggccgcgcctttcaccgcgacgcctacgcg
acgcagaacgagcaccccgagtacgccgccctacgagccgagacgcgcatcctcggaacg
tgggacgaccacgactacggcttcaacaacgcgggagcggagtggagggagaaggaattc
gcgcagcgcttattcctggatttcctcggcgaaccacttgggtccccgcgccgaacacgc
gcgggggtgtacgaggcgtacacgttcaggggcttgggcgcgtcccaaacgggcagcgcc
cggctcatcttactcgacgcgaggtttcacgcgagcgcaaaagacgggacgttgctcggc
gacgagcagtgggagtggttcgagcggctgatgctcgggaggaggacgggtgccgagggt
gccgaggggggtgccgagggtgccgaggactactacgacggcgacgacgagggacgtccg
agctcggaaccgcggggcggctgcgtggtgtttgacggcgcggagatgaacgaaaacacc
gactgcgacccggtggacgtgacgatcgtgggaagctccgtgcaggtccacgcgcacacc
caggagctgctcgcgaagatggggatcggcatggacatcgagtcgtggaacgactacccg
gcggagcgtcgccggctgttcgacctcgtcgccgcggctaacgttcggacgcgagccgtc
gtcctctccggagacgtccatcactcggagattggcgggtcacccgcggggtgcgacctg
ccgtccgagctcgtcgagattaccagcagcggcatgacgcacggggtgctggaggagctc
ccgacgaagttcctgagacggctggcgaggcactcgacgtgggggatggagtacctgccg
ccgtggctcttccccgacgtgggtaaccttcgccggcgtcgatacgtcgggtacaacttc
ggcgaggtggtcgtcgacttcggcgtcgactgggacggggatgccgaggggggtgccgag
gggggtgtcgatgacgacgcgttcgacgccgccgtcgacgcgtcccctcccgccaaccga
tcgcccgcgtctgagcgcgactttcttcgcgacgacgtgtcctcctcctcctcctcctcc
tcctcgtcgtcgagggtcggacgcgcgccgcgcgccgccgctcgggagccgaccgtctcg
cttcgcatccgcggcgtcgacgggggcgtcaagctgtcgaagacggtgccgttctccgcg
ctcgagggcgagtgggccgagtacggcgctcggggcgcgtcggtgagccgatcgcgtgcg
gagtgtcggggcgagtcttcgttgacggcggcgcagacgtggaggttgccggtgatgctg
gtcggggtggcgctggcgggacccgcggggacgtcgctcgcgttgtggtggctgtggagg
gaggttggccgcgttcggcggaagcgaaaggcggattga

DBGET integrated database retrieval system