KEGG   Micromonas sp. RCC299: MICPUN_59938Help
Entry
MICPUN_59938      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mis  Micromonas sp. RCC299
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MICPUN_59938
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MICPUN_59938
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     MICPUN_59938
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MICPUN_59938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:complement(join(464317..465648,465807..465866))
Genome map
AA seq 463 aa AA seqDB search
MGMSTRDQAVAARNASRQLQNLSSEDRAALLYAIADALEANEDAIMRENEKDIAAAEAAD
TESHLLNRLKMKPGKIAQLAAGARQIADMEEPLGRQLSKMKVADGLTLEQVTAPLGVLLI
IFESRPDALPQIASLAIRSGNGLLLKGGKEAAKTNAILHQIIVDCMPAFGVDRECIVLVE
GREAVSDILALHDVVDLVIPRGSNSLVSYISNNTKIPVLGHADGVCHMYLDPNADVKMAA
KLAVDSKTDYPAACNALETLLVHKSLIGKGKDGYETVAAALVAAGCTLHGGARAEKALKL
PACPAPRHEYGNLGLTVEIVDDMDQAIDYIHANGSGHTECIITNDKAAAEEFLRRVDSAC
VFHNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWLCRGDGHFVEKDTGVK
YTHQKLPLDANLAHKVASGLGWAVGIANAVHLGLMLWKMATKK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgtcaacccgcgaccaggccgtggcggcgcgcaacgccagccggcagctccag
aacctcagcagcgaggatcgcgccgcgctgctgtacgcgatcgccgacgccctcgaggcc
aacgaggacgccatcatgcgcgagaacgagaaggacatcgccgccgccgaggctgccgac
accgagtcgcacctcctcaacaggctcaagatgaagcccgggaagatcgcgcagctcgcg
gcgggcgccagacagattgccgacatggaggagccgctcggccgccagctcagcaagatg
aaggtggcggacggactcaccctcgagcaggtcaccgcgcccctcggagtcctcctcatc
atcttcgagtccaggcccgacgccctcccgcagatcgcctccctcgccatccgatccggc
aacggcctcctcctcaagggtggcaaggaggcggccaagaccaacgccatcctccaccag
atcatcgtcgactgcatgcccgcctttggcgtcgaccgcgagtgcatcgtcctcgtcgag
ggtcgcgaagccgtctcggatatcctcgcgctgcacgacgtcgtggacctcgtcatcccc
cgcgggtccaactcgctcgtctcctacatcagcaacaacaccaagatcccggtgctgggc
cacgcggacggcgtgtgccacatgtacttggacccaaacgccgacgtgaaaatggcggct
aagcttgcggttgattccaaaaccgactacccggcggcttgcaacgcgctcgagaccctg
ctcgtgcacaaatccctgatcggcaagggtaaggacgggtacgagaccgtcgccgcggcg
ctcgtggcggccgggtgcacgctgcacggcggtgcgcgcgcggagaaggcgctcaagctc
ccggcgtgcccggcgccccgacacgagtacgggaacctgggcctcaccgtcgagatcgtg
gacgacatggaccaggcgatcgactacatccacgccaacgggagcgggcacaccgagtgc
atcatcacgaacgacaaggcggccgccgaggagttcctgagacgggtcgacagcgcgtgc
gtatttcacaacgcgtccaccagattttccgacggtttcaggttcggactgggcgccgag
gtgggcatctccacgagccgcatccacgcgcgcgggcctgtcggcgtcgagggcctcctg
accacgaggtggctgtgccgcggcgacgggcacttcgtcgagaaggacacgggcgtcaag
tacacgcaccagaagctgccgttggacgcgaacctggcgcacaaggtggcgtcgggcctt
ggatgggccgtcgggatcgccaacgcggttcacctcgggctcatgctgtggaagatggcg
acgaagaagtga

DBGET integrated database retrieval system