KEGG   Micromonas sp. RCC299: MICPUN_60143Help
Entry
MICPUN_60143      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mis  Micromonas sp. RCC299
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mis00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    MICPUN_60143
Enzymes [BR:mis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     MICPUN_60143
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     MICPUN_60143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:join(842441..843248,843281..843351)
Genome map
AA seq 292 aa AA seqDB search
MPELPEVESARCLVEAHCIGAKVTKVEFNEDGSFDEKIFKDVERKAFVSALLNKTLTAAH
RRGKHMWWDMSGGADSPLFHFGMTGAFSIRGKGAMKYKAFVVDTSNWPPRFAKLVVTFDN
GIALAYTDPRRFGRIRLVRGDVTASPPISELGFDPLLAMPDEAAFASRFAKRGGPIKSVL
LDQTIAAGVGNWIADEVLYHSRLHPEQPAKSLTPAQLRDLRDAMEDVIKTACDAGADAEM
FPDDWLFHHRWGKVAGEVGGEPIQFITVGEENEREACGWREGGAQETRGRER
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcttcccgaggtggagagcgcgaggtgcctggtcgaggcgcactgcatcggc
gccaaggtgaccaaggtggagttcaacgaggacggaagttttgacgagaagatcttcaag
gatgtcgagcggaaggctttcgtctccgctctcttaaacaagaccctgacggcggcgcat
cgtcggggtaaacatatgtggtgggacatgagcggaggcgcggactcgcctctttttcat
ttcggcatgaccggggcattttccatccgggggaagggagcgatgaagtacaaggctttc
gtcgttgatacctcgaactggccgccgcgctttgccaagctcgtagtcacctttgacaac
ggcatcgcgctggcgtacacggacccgcgaaggttcgggcgcatcaggctggtacgcgga
gacgtcacggcgtcaccgcccatatccgagctcggcttcgatcccctgctggcgatgccc
gacgaggccgcgtttgcgtcgcgcttcgccaaacgcggcggtccaatcaagtcggtcctc
ctggaccagaccatcgccgcgggcgtgggcaactggatcgcggacgaggtcctctaccac
tcgaggctgcatccggagcagcccgcgaagtcgttgacgcccgcgcagctgagggatctg
agggacgcgatggaggacgtgatcaaaaccgcgtgcgacgcgggcgcggatgcggagatg
ttcccggatgactggctgtttcaccacaggtggggcaaggtcgcgggcgaggttgggggt
gaaccgattcagttcataaccgtcggggaagaaaacgagcgagaagcatgcggctggcgt
gaaggcggagcccaagaaacgaggggccgagaacgatga

DBGET integrated database retrieval system