KEGG   Micromonas sp. RCC299: MICPUN_60189Help
Entry
MICPUN_60189      CDS       T02695                                 

Definition
histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUN_60189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7:945056..946567
Genome map
AA seq 503 aa AA seqDB search
MDEQQEAKRRKLEALEAKMGGAPPPQAVRPAKMPNLPAVAPTPVSSAPTAAGASEEQTRS
PFVCDANDVVQFRLVRTEADMDAAEVFEPEFTHQVFRDDETVFGYRDLEIKIFMSANLFK
TLVEISYAEKVKSVLNPADDIMAMLKAHLGDDVFTDRDLFIETLRKDAAAPVPGGGGVVV
STWKTTGADGVEYVDTARVFRLSDPEIYPWHARFEPMILFYIDGASAVDSEDTRWLLFAV
IRTRADDADDASWSLVSFATVYEFFVYPSSTRARLSQIVVLPPHQRAGLGSKMLGAVREY
CVANGFADFTVEDPTPQLQRLRDAADVRAMTNAPEVMAAVRTCAMAAAALPRHVPAGTGG
TAASDEGKGVLEMPRAAAKFARDELKICAPQAARCWEALLYMTAKKAGAPDDSPAAAAFQ
ELVIRRLKALHCSDARRDAGSKRVYNHAQGRDDREFVMCRGVAGGQAPDMEEDGDKADPA
EVLADYFHDTMSNLAWLASAVKI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagcaggaagccaagcggcgcaagctcgaggctctcgaggccaagatgggc
ggcgcaccgccgccccaggccgtcaggcccgcgaagatgcccaaccttccagccgtcgct
ccgaccccggtttcttccgcgcccaccgccgcgggcgcgtccgaggaacagacgcgctcg
cccttcgtgtgcgacgccaacgacgtcgtgcagttccgcctcgttcgcaccgaggccgac
atggacgccgcggaggtcttcgagcccgagttcacccaccaggtcttccgcgacgacgag
accgtcttcggatacagggacctcgagatcaagatcttcatgtctgcgaacctcttcaag
acgctcgtggagatctcctacgccgagaaggtcaagagcgtgctcaatcccgcggacgac
atcatggcgatgctcaaggcacacctcggcgacgacgtcttcaccgaccgcgatttgttc
atcgagacgctccggaaggacgccgccgcgcccgtccccgggggcggcggcgtcgtcgtg
tcgacgtggaaaacgacgggagcggacggcgtggagtacgtcgacaccgcgcgcgtgttc
aggctctcggatccggagatatacccgtggcacgcgcggttcgagccgatgatcctgttc
tacatcgacggcgcctccgcggtggacagcgaggataccaggtggctcctctttgccgtc
atcagaacccgagcggatgacgcggacgacgcgtcgtggtcgctcgtgtccttcgcgacg
gtgtacgagttcttcgtctacccgtcctcgacgcgcgccaggctgtcgcagatcgtggtg
ctgcccccacaccagcgcgcgggtttgggaagcaagatgctcggcgcggtgcgcgagtac
tgcgtcgctaacggtttcgccgatttcaccgtcgaggacccgacgccccagctgcagcgg
ctgagggacgccgccgacgtcagggcgatgacgaacgcgccggaggtgatggccgcggtg
cggacgtgcgcgatggccgcggcggcgctgccccgacacgtgccagcaggcaccgggggc
acagcggcgagcgacgaagggaagggcgtgctcgagatgccgcgagcggcggcgaagttt
gcgcgggacgagctcaagatttgcgcgcctcaggcggctcggtgctgggaggctctgctg
tacatgaccgccaagaaggcgggcgcgcccgatgactcccccgcggcggcggcgtttcag
gagctggtcatcaggaggctcaaggcgctgcactgcagcgacgcgaggagggacgccggg
agcaagagggtgtacaaccacgcgcaggggcgcgacgatcgggagtttgtcatgtgccgg
ggcgtcgccggcggtcaggcgccggacatggaggaggacggggacaaggcggacccggcg
gaggtgctggcggactacttccacgataccatgagcaacctggcgtggctcgcgtcggcg
gtgaagatctga

DBGET integrated database retrieval system