KEGG   Micromonas sp. RCC299: MICPUN_60613Help
Entry
MICPUN_60613      CDS       T02695                                 

Gene name
HEMG
Definition
protoporphyrinogen IX oxidase chloroplast precursor
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mis  Micromonas sp. RCC299
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MICPUN_60613 (HEMG)
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MICPUN_60613 (HEMG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8:complement(417568..419199)
Genome map
AA seq 543 aa AA seqDB search
MALSVTLSASAVATTTGGRFNVKRTSPGRRAARPAARGLVVRVAADSDYDAVVIGAGVSG
LSTAFTLGRSSPGVRMLVTEARDRVGGNITTKNENGYIWEEGPNSYQPGDAILTVACDAG
MRDDILLADPNSDRYVLWDKELRALPKDIPTAVLGTFLTWPGKIRAGLGAIGIRPPPPGK
EESVKEFVSRNLGTEAFERLIEPFCSGVYAGDPAALSSVAATGRVQRLEPLGGSLVFGAL
KAQKEAYDAKKARGPRDPRLPKVEGQTVGSFRGGLKTFPEGLAKALGSEKVKLEWKVTKI
AKRDDGSFAITYDTPDGEKQITTATVVMTAPAYVTADTVQDMAPDAAAALRKFYYPPVAS
VTVSYPEDSFRLDGTSALPGGGLTGFGQLHPRSQGIRTLGTIYSSYLFKDDKRQPEGEFM
ILNYIGGARDTGITQLSDEELVKAVHEDALKTILKPGTPLPKVVGVKVWEKAIPQFNLGH
LDVLAEAKAGLAKAGCDGLFLGGNYTAGVALGRCVEFGVEQAKDLETYLSKQSAKKGASV
PAR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctccgtcaccctctcggcctcagcggtcgccaccacaaccggtggccgcttc
aacgtcaagcgcacctctccaggaaggcgcgccgcccgtcccgccgcgcgcgggctggtc
gtccgcgtcgcggccgactccgattacgacgccgtggtaataggcgcgggcgtgtccggc
ctgtccaccgcgttcacgctcggcaggtcctcgcccggcgttcgaatgctggtcaccgag
gccagggaccgcgtgggaggtaacatcaccacgaagaacgagaacgggtacatctgggag
gagggtcccaactcttaccagcccggcgacgcgatcctcaccgtggcgtgcgacgcgggc
atgagggacgacatcctcctcgccgatcccaactcggaccgctacgtcctctgggacaag
gagctccgggcgctccccaaggacattcccaccgcggtcctcggcaccttcctcacctgg
ccgggcaagatccgcgcgggcctcggcgcgatcggcatccggcccccgcccccgggcaag
gaggaatccgtcaaggaattcgtctcgcgaaacctcggcacggaggctttcgagaggctc
atcgagcccttctgctccggcgtctacgcgggcgaccccgcggcgctctcgtccgtcgcg
gccaccggcagggtccagcgcctggaacccctcggcggctccctcgtcttcggcgccctc
aaggcgcagaaggaggcatacgacgccaagaaagcccgggggcctcgagatccgcgactg
ccaaaggtggagggccagacggtgggatccttccgcggggggctgaagacgttccccgag
ggcctcgccaaggcgctcggctcggagaaggtcaagctcgagtggaaggtgacgaagatc
gccaagcgggacgacggttcgttcgccatcacctacgacacccccgacggggaaaagcaa
atcaccacagccaccgtggtgatgaccgcgccggcttacgtcaccgccgataccgtgcag
gacatggcgcccgacgccgccgccgcgctccgaaagttctactatccgcccgtcgcgtcc
gtgaccgtctcctaccccgaggattccttccgtttggacggaacctccgcgcttcccgga
ggcggtctcaccgggtttgggcagcttcacccgcggtcgcagggcatccgcacgctcggc
accatctactcgtcctacctgttcaaggacgataagcgccagccggagggtgagttcatg
atactcaactacatcggcggcgcgagggacaccggcatcacgcagctgtccgacgaggag
ctcgtcaaggcggtgcacgaggacgcgctcaagacgatcctcaagcccggcacccctctg
cccaaggttgtgggcgtcaaggtgtgggagaaggccatcccccagttcaacctcgggcac
ctggacgtgctggcggaggccaaggcgggcttggcaaaggcggggtgcgacgggctgttc
ctgggcggtaactacaccgcgggtgtcgcgctgggacggtgcgtggagtttggcgtcgag
caggcgaaggacctcgaaacgtacctttccaaacagtccgcaaagaagggcgcctcggtg
cccgcgcgctaa

DBGET integrated database retrieval system