KEGG   Micromonas sp. RCC299: MICPUN_62047Help
Entry
MICPUN_62047      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     MICPUN_62047
    1.3.1.94  polyprenol reductase
     MICPUN_62047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10:complement(833814..834896)
Genome map
AA seq 360 aa AA seqDB search
MLIQASRFVNSFWLIFFGLSVVADLNLVPGLSGFLRAVAKRGKDDEGDDPAGKRRRPWWQ
VTVPHGWFTHFYVVGVLWNAVALFHSLIECAWAGSDPSVVGAALASTLFQAHVTRRLYES
AFVSIHRPGGRMHVVGYLIGVVYYICVPLTLAHPLAAAAVVGSVTDAWRRGSIAYLLEPV
DGTKLAAAADGIRHVLKFAFTASGRSGVGALMSGFCVMGGVYAWGVGNAHQHRYHVALAK
LRGGEKKRENVEKKERTGAAKEYGVPRGGWFESVSCPHYAAEVLLYVGICAVACGSGLGA
GGIATGAAGFGPAAALARTAPMLASVAGNLSIAARRNHEWYLRHMPDYPKGRWAMIPGIL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgttgatccaagcatcgcgcttcgtcaacagcttctggctgatcttcttcggcctcagc
gtcgtcgcggacctgaacctcgtccccggcctctccggcttcctccgagcggtcgccaag
cgcggcaaggatgacgagggcgacgatccggccgggaagagacgacgaccgtggtggcag
gtcaccgtgccgcacggctggttcacccacttctacgtcgtcggcgtgctgtggaacgcg
gtcgcgctgtttcattcgctgatcgagtgcgcgtgggcgggctctgacccgtcggtggtg
ggcgcggcgctcgcgtcgacgctcttccaggcgcacgtcacgaggcgcctgtacgagtcc
gcctttgtgtccatccacagaccgggcgggcgcatgcacgtcgtggggtacctgatcggc
gtcgtctactacatctgcgtccccctcaccctggcgcacccgctcgcggcggccgccgtc
gtgggatccgtcaccgacgcgtggcgccgcgggtcgatcgcgtacctgctcgagcccgtc
gacgggacgaagctcgcggcggcggcggatggtatccggcacgtcctcaagttcgcgttc
accgcaagcgggaggtccggcgtgggcgcgctgatgagcggcttctgcgtcatgggcggc
gtgtacgcgtggggggtgggtaacgcgcaccagcacaggtaccacgtcgcgctcgccaag
ctccgcggcggggaaaagaagcgagaaaacgtcgagaagaaggagcgaacgggcgccgcg
aaggagtacggcgtgccccgcgggggttggttcgagtcggtatcgtgccctcactacgcc
gcggaggtgttactgtacgttgggatctgcgcggtggcgtgcgggtcggggctcggcgcg
ggggggatcgcgacgggcgcagccggattcgggccggcggcggcgctcgcgcggacggcg
ccgatgctcgcgtcggtggcgggcaacctgtcaatcgcggcgagacgaaaccacgagtgg
tacctgcgtcacatgccggactatcccaagggcaggtgggcgatgataccgggaatcctg
tga

DBGET integrated database retrieval system