KEGG   Micromonas sp. RCC299: MICPUN_63089Help
Entry
MICPUN_63089      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mis  Micromonas sp. RCC299
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MICPUN_63089
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MICPUN_63089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12:join(527211..527244,527474..528414)
Genome map
AA seq 324 aa AA seqDB search
MGTEKKECLMPDAMPFVTAEMLFLPQGRDVEAVCLTVFAVIVALIYLVDALAPKAKKALD
PSKKVALKLVKRTELSHDTHMFRFGLPTPEHILGLPIGQHIALSYTDKDGKEQGRPYTPT
SSDVDKGHVDFVIKVYFPNERFPEGGKVSQHMHSLKIGDTLDFSGPKGRYEYRGKGTFAI
KRLKSQGGGFEIRKAKKIGMIAGGTGITPMLQVMRAVFRDKGDKTDMSLIFANQTEEDIL
LRDELDKCERDHDNFKLHYTVDRPPAKGWRYDTGFVTAEMIKKHMPPPSKDTQILLCGPP
PMIKFAIMPAFEQLGYTKDMFLQW
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcacggaaaaaaaagaatgtctcatgccagacgcgatgccattcgtgacggcggag
atgttgttcctcccacaggggcgagacgtcgaggcggtgtgtctcaccgtgttcgccgtc
atcgtggcgctaatttacctcgtggacgcgctcgccccaaaggctaaaaaagcgctggat
cccagcaagaaggtggcgctgaagctggtgaagcgcacggagctgtcgcacgacacccac
atgttccgcttcggccttcccacccccgagcacatcctcggccttcccatcggccaacac
atcgcgctgtcctacacggacaaggacgggaaggagcaggggcgcccttacacgccgact
tcgtcggacgtggacaaggggcacgtcgacttcgtcatcaaggtctacttccccaacgag
cgcttccccgagggcgggaaggtgtcgcagcacatgcactcgctgaagatcggcgacacc
ctggacttctcggggccgaagggtaggtacgagtacaggggcaagggtacgttcgccatc
aagaggctcaagtcccagggtggcgggttcgagatccgcaaggcgaagaagatcgggatg
atcgcgggtggcaccggcatcacgccgatgctgcaggtcatgcgcgcggtcttccgagac
aagggggacaagaccgacatgtccttaatcttcgccaaccagaccgaggaggacattctc
ctgcgcgacgagctcgataagtgcgagcgggaccacgacaactttaagctccactacacc
gtggacaggccgccggccaagggatggcgctacgacaccggcttcgtcaccgcggagatg
atcaagaagcacatgccgccgcccagcaaggacacgcagatcctactctgcggaccgccg
ccgatgatcaagttcgccatcatgcccgcgttcgagcagctgggctacaccaaggacatg
ttcctccagtggtag

DBGET integrated database retrieval system