KEGG   Micromonas sp. RCC299: MICPUN_71829Help
Entry
MICPUN_71829      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mis  Micromonas sp. RCC299
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MICPUN_71829
  Biosynthesis of other secondary metabolites
   00965 Betalain biosynthesis
    MICPUN_71829
Enzymes [BR:mis01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MICPUN_71829
Exosome [BR:mis04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MICPUN_71829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10:complement(<719580..>720167)
Genome map
AA seq 196 aa AA seqDB search
IIPYIKATANEGDPASVLTAMDTFGRYYPMYKLGDEKGRILAGLVKERQPRRSVEIGTFL
GYSAIWTASNLPRGATLTCVEFEPRHAAVARELVRFAGFANTVEILEGAGSERVPDVRRR
VGEGVAADMIFLDHCKECYLPDLKLMEGAGLVGKGTIVVADNVIYPGAPDFLDYVDTSRG
RYETTLLEAAFEYDQV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ataattccttacatcaaggccacggccaacgagggtgacccggcgtccgtgctcaccgcc
atggacaccttcgggaggtattaccccatgtacaagctcggcgacgagaagggacgcata
ctcgccgggttggtgaaggagcgccagccgagaaggtccgtcgagatcggcacgttcttg
gggtacagcgccatatggaccgcgtccaacttaccacgcggcgccaccctgacgtgcgtc
gagttcgagcccaggcacgccgccgtcgcgagggagcttgtgcgattcgcgggatttgcg
aatacggtcgagatcctcgagggcgcggggtcggagcgggtaccggacgtgaggaggcgg
gtgggcgagggcgtcgcggcggacatgatcttcctggaccactgcaaggagtgctacctg
cccgacctcaagctgatggagggcgccggtctcgtcggaaaagggacgatcgtcgtcgcc
gataacgtgatttatccaggggctccggactttctggattacgtggacacgagccgcggt
cggtacgagacgacgctgctggaggctgcgttcgagtacgatcaggtg

DBGET integrated database retrieval system