KEGG   Micromonas sp. RCC299: MICPUN_71829Help
Entry
MICPUN_71829      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mis  Micromonas sp. RCC299
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mis00350]
Metabolism; Biosynthesis of other secondary metabolites; Betalain biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10:complement(<719580..>720167)
Genome map
AA seq 196 aa AA seqDB search
IIPYIKATANEGDPASVLTAMDTFGRYYPMYKLGDEKGRILAGLVKERQPRRSVEIGTFL
GYSAIWTASNLPRGATLTCVEFEPRHAAVARELVRFAGFANTVEILEGAGSERVPDVRRR
VGEGVAADMIFLDHCKECYLPDLKLMEGAGLVGKGTIVVADNVIYPGAPDFLDYVDTSRG
RYETTLLEAAFEYDQV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ataattccttacatcaaggccacggccaacgagggtgacccggcgtccgtgctcaccgcc
atggacaccttcgggaggtattaccccatgtacaagctcggcgacgagaagggacgcata
ctcgccgggttggtgaaggagcgccagccgagaaggtccgtcgagatcggcacgttcttg
gggtacagcgccatatggaccgcgtccaacttaccacgcggcgccaccctgacgtgcgtc
gagttcgagcccaggcacgccgccgtcgcgagggagcttgtgcgattcgcgggatttgcg
aatacggtcgagatcctcgagggcgcggggtcggagcgggtaccggacgtgaggaggcgg
gtgggcgagggcgtcgcggcggacatgatcttcctggaccactgcaaggagtgctacctg
cccgacctcaagctgatggagggcgccggtctcgtcggaaaagggacgatcgtcgtcgcc
gataacgtgatttatccaggggctccggactttctggattacgtggacacgagccgcggt
cggtacgagacgacgctgctggaggctgcgttcgagtacgatcaggtg

DBGET integrated database retrieval system