KEGG   Micromonas sp. RCC299: MICPUN_79903Help
Entry
MICPUN_79903      CDS       T02695                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MICPUN_79903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(655294..655437,655620..657002)
Genome map
AA seq 508 aa AA seqDB search
MSGKPKISYFYDPDVGNFYYGQGHPMKPHRVRMTHNLLLHYGIYKEMEVFRPALASAEDM
TKFHSDEYIEFLRLITPDNQHEHMRQLKRFNCAEDCPVFDGLFNFCQIYTGGSVGGAVRL
NHKQTDTVVNWAGGLHHAKKNEASGFCYVNDIVLAILELLKVHQRVLYIDIDIHHGDGVE
EAFYTTDRVMTVSFHKFGEYFPGTGHLQDVGQHRGKYYSVNVPLKDGIDDEAYVALFKPV
MAKVMEMYQPDAVVFQSGADSLTGDRLGCFNLSIRGHGECLKYMQTFNVPLLVLGGGGYT
IRNVARCWTYETGCLLGHDLDNKLPVNDYSEYFGPTHELQIQPSNMENQNTPEYLQGILN
KILENLSKIPPKPSVPFHDVPPDAIDQDAMRVKEDPDAKGGGAEAEAARRSDPRELEPED
GDVDDKPSRHDASMRDVEDVDGGEKKVKEEKVEGADAVKAELGDAADVDDPDAAVKAEKG
GEGATDANDGDAANAGGPGIMASDHGDQ
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggaagcctaagatctcgtacttttacgaccccgacgtgggcaacttctactac
ggacagggtcatccgatgaagcctcaccgtgtccgcatgacccacaacctcctcctgcac
tacggcatctacaaggagatggaggtgttccgcccggcgctcgcgtccgccgaggacatg
accaagttccacagcgacgagtacatcgagttcctccgcctcatcacccccgacaaccag
cacgagcacatgaggcagctcaagcgcttcaactgcgccgaggactgcccggtgttcgac
ggcctgttcaacttctgccagatctacaccggcggctccgtgggcggtgcggtccgtctg
aaccacaagcagacggacaccgtcgtcaactgggcgggtggcctccaccacgcgaagaag
aacgaggcttccggcttttgctacgtcaacgacattgtgctcgcgatcctcgagctgctc
aaggttcaccagcgcgtgctgtacatcgacatcgacatccaccacggtgacggcgtggag
gaggccttctacaccaccgatcgcgtcatgaccgtctcgttccacaagtttggcgagtac
tttccgggcaccggacacctccaggacgtgggccagcaccgcggtaagtactactccgtc
aacgtcccgctcaaggacggcatcgacgacgaggcctacgtggcgctgttcaagccggtg
atggcgaaggtcatggagatgtatcagccggatgcggtggtgttccagtccggcgcggat
tccctcaccggcgacaggctcgggtgcttcaacctctccatccgcggccacggcgagtgc
ctgaagtacatgcagaccttcaacgtgcccctcctggtgctcggcggcggtgggtacacc
atccgcaacgtcgccaggtgctggacgtacgagaccggttgcctcctcggccacgacctc
gacaacaagcttccggtgaacgactactccgagtactttggccccacgcacgagctccag
atccagccgtccaacatggagaaccagaacacgcccgagtacctgcagggcatcctcaac
aagatcctcgaaaatttgagcaagatcccgcccaaaccgtccgtcccgttccacgacgtg
ccccccgacgccatcgaccaggacgccatgcgggtcaaggaggatccggacgccaagggc
ggcggcgcggaggctgaggcggcgcggcggtcggatccccgcgagctcgagcccgaggat
ggcgacgtcgacgacaagccgtccaggcacgacgcgtccatgcgcgatgtagaggacgta
gacggcggcgagaagaaggtcaaggaggagaaggtggagggagcggacgcggtcaaggcg
gagctcggcgacgcggctgacgtcgacgatcccgacgcggcggtcaaggcggagaagggc
ggcgagggcgcgacggacgcaaacgacggggacgcggcaaacgcggggggacctgggatc
atggccagcgaccacggcgatcagtga

DBGET integrated database retrieval system