KEGG   Micromonas sp. RCC299: MICPUN_81480Help
Entry
MICPUN_81480      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mis  Micromonas sp. RCC299
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MICPUN_81480
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MICPUN_81480
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MICPUN_81480
Lipid biosynthesis proteins [BR:mis01004]
 Desaturase
  First
   MICPUN_81480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(1294318..>1295205)
Genome map
AA seq 295 aa AA seqDB search
KVLWSDVLYSPKREAFLRKWVPTDITYASFIGVMHLGCLLAPFTFTWSAFNCFLVMYFIT
GCLGITLSYHRQLSHKSFTTPKWLEYALAYCGAMAVQGDPLEWASSHRHHHQHCDTPKDP
HTPYEGFWWSHCGWLLDNEATLKRVGDRSNAQELAAQPFYRFMEKTYMWHVLAQAVALYA
MGGLPWLVWGFCVRTCWVYHITWAVNSVSHVWGSQTYNTGDLSRNNWWIGILAFGEGWHN
NHHAFEFSARHGLEWWQIDMTWMCICVLKFFGLADKVKLPKQAQMDRMRIKPAAA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
aaggtgctctggtccgacgtgctctactcccccaagcgcgaggcgttcctccgcaagtgg
gtccccacggacatcacgtacgcgtctttcatcggcgtcatgcacctcggatgcctcctc
gcgcccttcaccttcacctggtccgcgttcaactgcttcctcgtgatgtacttcatcacc
ggctgcctcggcatcacgctctcctaccacaggcagctgagccacaagagcttcaccacg
cccaagtggctcgagtacgctctcgcgtactgcggcgccatggcggtgcagggcgacccg
ctggagtgggcgtcgtcgcacaggcaccaccaccagcactgcgacacccccaaagacccc
cacaccccttacgaggggttctggtggtcgcactgcggctggctcctcgacaacgaggcg
actctgaagcgcgtcggcgaccgcagcaacgcgcaggaactcgcggcgcagccgttttat
aggttcatggagaagacgtacatgtggcacgtgctcgcgcaggcggtggcgctttacgcg
atgggcggcctgccctggctcgtgtggggtttctgcgtccgcacgtgctgggtgtaccac
atcacgtgggcggtcaactccgtctcgcacgtgtggggctcccagacgtacaacacgggc
gatctgagccgaaacaactggtggatcgggatcctggcgttcggcgaggggtggcacaac
aaccaccacgccttcgagttctccgccaggcacgggctggagtggtggcagattgacatg
acctggatgtgcatctgcgtgctcaagtttttcgggctcgcggataaggtgaagctgccc
aagcaggcgcagatggaccgcatgcgcatcaagcccgccgccgcgtga

DBGET integrated database retrieval system