KEGG   Micromonas commoda: MICPUN_81480Help
Entry
MICPUN_81480      CDS       T02695                                 

Definition
(RefSeq) hypothetical protein
Organism
mis  Micromonas commoda
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(1294318..>1295205)
Genome map
AA seq 295 aa AA seqDB search
KVLWSDVLYSPKREAFLRKWVPTDITYASFIGVMHLGCLLAPFTFTWSAFNCFLVMYFIT
GCLGITLSYHRQLSHKSFTTPKWLEYALAYCGAMAVQGDPLEWASSHRHHHQHCDTPKDP
HTPYEGFWWSHCGWLLDNEATLKRVGDRSNAQELAAQPFYRFMEKTYMWHVLAQAVALYA
MGGLPWLVWGFCVRTCWVYHITWAVNSVSHVWGSQTYNTGDLSRNNWWIGILAFGEGWHN
NHHAFEFSARHGLEWWQIDMTWMCICVLKFFGLADKVKLPKQAQMDRMRIKPAAA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
aaggtgctctggtccgacgtgctctactcccccaagcgcgaggcgttcctccgcaagtgg
gtccccacggacatcacgtacgcgtctttcatcggcgtcatgcacctcggatgcctcctc
gcgcccttcaccttcacctggtccgcgttcaactgcttcctcgtgatgtacttcatcacc
ggctgcctcggcatcacgctctcctaccacaggcagctgagccacaagagcttcaccacg
cccaagtggctcgagtacgctctcgcgtactgcggcgccatggcggtgcagggcgacccg
ctggagtgggcgtcgtcgcacaggcaccaccaccagcactgcgacacccccaaagacccc
cacaccccttacgaggggttctggtggtcgcactgcggctggctcctcgacaacgaggcg
actctgaagcgcgtcggcgaccgcagcaacgcgcaggaactcgcggcgcagccgttttat
aggttcatggagaagacgtacatgtggcacgtgctcgcgcaggcggtggcgctttacgcg
atgggcggcctgccctggctcgtgtggggtttctgcgtccgcacgtgctgggtgtaccac
atcacgtgggcggtcaactccgtctcgcacgtgtggggctcccagacgtacaacacgggc
gatctgagccgaaacaactggtggatcgggatcctggcgttcggcgaggggtggcacaac
aaccaccacgccttcgagttctccgccaggcacgggctggagtggtggcagattgacatg
acctggatgtgcatctgcgtgctcaagtttttcgggctcgcggataaggtgaagctgccc
aagcaggcgcagatggaccgcatgcgcatcaagcccgccgccgcgtga

DBGET integrated database retrieval system