KEGG   Micromonas sp. RCC299: MICPUN_86873Help
Entry
MICPUN_86873      CDS       T02695                                 

Gene name
DPE2
Definition
glycoside hydrolase family 77 protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUN_86873 (DPE2)
Enzymes [BR:mis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MICPUN_86873 (DPE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
12:join(379405..379542,379736..380107,380168..380454,380728..382599,382789..383047)
Genome map
AA seq 975 aa AA seqDB search
MSVIPKTTVGFRIKYWTEWGQNLVVCGNDPRLGSWDVRKGVFMRCQHLGEDQLLWTGSVT
GHFVGSFDYRYAVVDRDMNVVRWDAIVRHAHFAPAMPEGRGGGSDDNSSEASGSAVGYGR
DKVEIQDTWEFQSHPENLFARESFRDVALDDGSGKNVERALDALPEPSTHSRDFIHIRLE
VRTLRLLPGQRLTATGDCAALGGWERDAAPVMNLDAVTRTWWLDFDVAPEDLPVRYKYAL
RGATRAADAMEKGVDRVVAPLGWIGESPSRIVARDGHFRYPGAWRGSGLAAPVFSLRSCD
SVGAGDFVDLRTLVDVAHAGGMNVVQVLPVNDTTVHNMWWDSYPYSSVSVFALHPLYLRI
QQVVSEAARIAGPEHTNRFASLQAEVNKAKAALDLKEVDYEATVKVKMSVARRCFEAVKT
PFLNSTEFSEFLAENAAWLKPYAVFCALRDLFGTAQHWRWGSLGSDNSAGTVTRLSQPGS
EVYNTVALHYFVQFHLDAQLRAAAAHAKRVGVILKGDLPIGVDKASVDTWMYPNLFRMHT
STGAPPDDFDPNGQNWGFPTYNWEEMSKDGYGWWRARMSHLERYFSAMRIDHVLGFFRIW
ELPAHTRVGRMGRFRPSVPIRRHELEQRGLWFVDRLCEPRVTSSILREIFGDRDGEVAGR
FMEETGHDGHLPDGRAINTYRFKAEFSTEEGLLGSDAFKIRDGSPDWLVEETEAMRKGLL
HLQHNVCLLRDPEDPDAFYPRIEMQKTSSFNELEGWSKDALNWLYDDYFGARQDTLWREN
ARRTLPALMTCTGQLVCGEDLGMVPPCVPPVLDELGILGLRIQRMPHDEGEFGRPNRYPY
ATVCSPSCHDTTTTRAWYEADRHRRARYAHQVLGMQGDGQLASCFPPPMAAIVRQHMASP
SALAIFPAQDLLALESSYAQRPAEEETINDPTNNRHYWRFRLHVRLEDMLANSEWLADIR
EMVNESGRVDGKMTT
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcatcccgaagacgacggtgggcttccggatcaagtactggaccgagtggggc
caaaacctcgtcgtgtgcgggaatgatccccgtctgggctcgtgggacgttcgcaagggc
gtgttcatgcgatgccagcatctcggcgaggatcagctcctgtggaccgggagcgtcacg
ggccacttcgtcggatcgttcgattacaggtacgcggtggtggacagggacatgaacgtg
gtgcgatgggacgcgatcgtccggcacgcgcacttcgccccggcgatgcccgagggtagg
ggcgggggcagcgacgataacagcagcgaagcctccgggagcgcggtcggatacgggagg
gacaaggttgagatccaggacacgtgggagtttcagtcgcatcccgagaacctcttcgcg
cgagagtcctttcgcgacgtcgcgctcgacgacggatccggtaagaacgttgaacgagcg
ctcgacgcgttacccgaaccctcgacgcactcgcgcgatttcatccacatccgcctcgag
gtgcgcacgctgcgactgctgcccggccagcggctcacggcgacgggcgactgcgccgcg
ctcggcgggtgggagagggatgccgcgccggtgatgaacctcgacgcggtgacgcgcacg
tggtggctggactttgacgtcgcccccgaggatttaccggtgaggtacaagtacgcgctg
cggggcgcgacgcgagcggcggatgcgatggagaagggcgtcgatcgcgtggtggcgccc
ctgggttggataggcgagtccccgtcgcgtatcgtcgccagggatgggcactttcgctat
ccgggcgcgtggcgcgggtccgggttggcggcgcccgtgttttcgcttcgatcgtgcgac
tcggttggcgccggggactttgtcgatctcaggacgctcgtggacgtggcgcacgcgggc
gggatgaacgtggtccaggtgttaccggtgaacgacacgacggtgcacaacatgtggtgg
gactcgtacccgtactcgtccgtgtcggtctttgcgctgcacccgctgtacctgcggatc
cagcaggttgtgtcggaggcggcgagaatcgccgggcccgagcacaccaacaggttcgcg
agcctgcaggccgaggtcaacaaggccaaggcggcgctcgatttgaaggaggttgactac
gaggcgacggtgaaggtaaagatgtccgtcgccaggcggtgcttcgaggctgtcaagacc
cctttcctcaactcgaccgagtttagcgagtttctcgccgagaacgccgcttggctcaaa
ccctacgccgtgttctgcgccctgcgcgacctctttggcactgctcagcattggaggtgg
ggctcgctcggctcggacaacagcgcgggcacagtgacgcgcctgtcgcagcccggcagc
gaggtttacaacaccgtcgcgttgcactactttgtccagttccacctggacgcgcagctc
cgcgcggcggctgcgcacgccaagcgcgtgggcgtgatcctcaagggcgacctgcccatc
ggcgtggacaaggcgagcgtggacacctggatgtaccccaacctgttccgcatgcacacc
agcacgggcgcccccccggacgatttcgacccgaacggtcagaactggggcttccccacg
tacaactgggaggagatgagcaaggacgggtacgggtggtggcgcgcgaggatgtcgcac
ctcgagcggtacttctccgcgatgcgaatcgaccacgtcctgggattcttccgcatctgg
gagctcccggcgcacacgcgcgtggggcggatgggtcggttccgtccctcggtgcccatt
cggcgccacgagctcgagcagaggggcttgtggttcgtggaccgcctgtgcgagccgcgc
gtgacgtcgtcgattcttcgggaaattttcggcgatcgcgacggcgaggtggccggtcgg
ttcatggaggagaccgggcacgacgggcacctacccgacggccgcgcgatcaacacgtac
aggttcaaggccgagttcagcacggaggagggtttgctgggctcggacgcgtttaagatt
cgggacggctcgccagattggctcgtcgaggagacggaggctatgcgaaagggtcttctc
cacctgcagcacaacgtgtgtctgctgcgggaccccgaggacccagacgcgttctacccg
cgcatagagatgcagaagacgtcctcgttcaacgagctcgagggctggtctaaggatgcc
ctcaactggctctacgacgactatttcggcgccaggcaggatacgctctggagggaaaac
gcgaggcgcacgctgcccgcgctgatgacgtgcaccggtcagctcgtgtgcggcgaggac
ctgggcatggtcccaccgtgcgtcccgcccgtgctggacgagctcggcatcctgggcctg
cgcatccagcgcatgccccacgacgagggtgagtttggccgaccgaacaggtacccctac
gcaaccgtgtgctccccgtcgtgtcacgacaccaccaccacgagggcgtggtacgaagcc
gaccgacacaggcgcgcgagatacgcgcaccaggtgctcgggatgcagggcgacgggcag
ctcgcgtcctgcttcccgccgcccatggcagccatcgtccggcagcacatggcgtctccc
agcgcgctggcgatattccccgcgcaggacctgttggcgctcgagtcatcctatgcgcag
cgaccggcggaggaggagacaatcaacgacccgacgaacaacaggcactactggaggttc
aggctgcacgtgcgtctggaggacatgctcgccaactcggagtggctcgcggacatcagg
gagatggtgaacgagagcgggagggtggatgggaagatgacgacctga

DBGET integrated database retrieval system