KEGG   Micromonas sp. RCC299: MICPUN_87470Help
Entry
MICPUN_87470      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mis  Micromonas sp. RCC299
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MICPUN_87470
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MICPUN_87470
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MICPUN_87470
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MICPUN_87470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13:join(285476..285739,286039..287115)
Genome map
AA seq 446 aa AA seqDB search
MKVAQVNHKGDPAVSAALKEALHKKAQNDQKIVVIKVGTSSLLRKGYLHLSLLGQLAETC
ADLHRAGCKVIVVTSGAVGAGCQVLNNADKPTDLAGKQAMAAIGMVRLMRMYDDFFTSVS
QPIAQVLVSLDNLMDRTQYLNAQRTFQALLARDVIPIVNENDTIAVQDLKFGDNDTLSAH
IASLCDADYLFLLTDVDGLYTGNPNSDPDARLIPLVESIDDLDVDVSGGAGSAFGTGGMA
TKVNAARLATAAGCHTVVMNSNQLHTLPDIVVDGASNGTLFLAVPRPLVGRKRWILLQKP
AKGYLLVNSKAEQALNNDKSLHGIHLVSVVGDFDAAEAVALVVRDSETGDEREFGRAIVN
YGADDCRKLVGKAGEDFYDIVGFGGAESVAHKNNICLWIPEGEEARLMDHPEINMETHPS
VNNLEDLAEFMSDKPSRTPSPSPFTL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgcgcaggtgaaccataaaggcgatcccgctgtgagcgccgcgctgaaggag
gcgctgcataagaaggcgcagaatgaccaaaagatcgtggttatcaaagttggcacgtcc
tccctgctgcgcaagggctaccttcacctctcgctcctcggccagctggcggagacgtgc
gccgatttgcatcgcgccggatgcaaggtcatcgtcgtaacctccggcgcggtcggagcc
gggtgccaagtcctcaacaacgcggacaaacccacggatctcgcgggcaaacaggccatg
gccgccattggtatggtccgactcatgcgcatgtacgacgatttcttcacctcggtgagc
cagcccatcgctcaggtgctggtgagcctcgacaacctgatggaccgcacgcagtacctc
aacgcgcagcgcacgttccaagcgctgctcgcgcgcgatgtcatccccatcgtcaatgag
aacgacaccatcgccgtgcaggacttgaagttcggcgataacgacaccctttccgcgcac
atcgcctctctgtgcgacgccgactacctattcctcctcaccgacgttgacggcctctac
accggcaaccccaacagcgacccagatgccaggctgattcccttggtggagagcatcgat
gacctcgacgtggacgtgagcggcggcgctgggtctgcgttcggaaccggcggcatggcg
acgaaggtgaacgcggcgaggctcgcgaccgccgccggttgccacaccgttgtgatgaac
agcaaccagctccacacgctcccggacatcgtggtggacggtgcgagcaacgggaccctg
ttcctcgctgtgccccgcccgctggtgggccgcaagcgctggatcctcctccaaaagccc
gccaagggatacctgctggtgaactccaaggctgagcaggcgctgaacaacgacaagtcc
ctccacggcatccacctcgtctccgtcgtgggcgatttcgacgcggcagaggcggtggcg
ctcgtggtgagggactctgagactggcgacgagcgcgagtttggacgcgccatcgtcaac
tacggcgcggatgactgcaggaaactggtcggaaaggcgggcgaagacttttacgacatc
gtcgggtttggcggcgccgagtctgtggcgcataaaaataacatctgcctgtggatcccc
gagggcgaggaggcgagactgatggatcatcccgagatcaacatggagacgcacccgagc
gtcaacaaccttgaggacctcgcagagttcatgagtgacaaacccagcaggacgccctcg
ccgtcgcctttcacactttga

DBGET integrated database retrieval system