KEGG   Micromonas sp. RCC299: MICPUN_89545Help
Entry
MICPUN_89545      CDS       T02695                                 

Gene name
DPE1
Definition
glycoside hydrolase family 77 protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUN_89545 (DPE1)
Enzymes [BR:mis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MICPUN_89545 (DPE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(896303..898011,898144..898285))
Genome map
AA seq 616 aa AA seqDB search
MAWSLLSNAPSLSTHPSSRRFCLKWNDSPRSFRKIRSLRAKASMLEIGEPVHDGYTEMLP
PRRAQRRAGVIMHPTSLPGHYGIGDLGKEAFAFIDWLADAKMQVWQILPLVPPGRPIPGF
REDYWSPYSGRDAHCGNTLIISLDELVADGLLTEQELPQPYNLSGNVDFSRVAEINEPLI
ARAAKRLLERSDDDSLKSSLATWRSRPEIKSWIEEAALFDAICNDPNLVGKDWWDWPEDL
RRRDPAKLEQKRASAAAHIEEFCATQFLFDKQWLKLKTYANSQGISIIGDMPIYVGGHSA
DVWANQSLFLLGDDFKPTSVAGVPPDAFSEDGQLWGNPLYDWRSHSQENYRWWAGRIGRA
LQLHDEVRIDHFRAFAAYWSVPASAKTAKNGSWIVGPGKSFFDGVEKVVGDAPIVAEDLG
VITKDVVDLREAIEAPGMVVLQFAWGGDKQSPHLPHNFCENSFCYPGTHDNQTTEGWYEN
LDEATKVKLANYAGISDAEGAAWGLIRLGMSSVSKACVFTMQDVLGLGDEARMNTPGVAD
GNWAWRIGPPGIFATCSPQAKKLASLATCFDRVSPEHMINKKNIEVESPKANDDVTPDGD
GSDANRPCRQKFFGVF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggtccctgctgagcaacgcaccatctctctcaacgcacccttcatcgcggcgt
ttttgtttgaaatggaacgactctccacgtagttttcgcaaaatacgctcgttgcgtgcc
aaggcctctatgctagagatcggcgaaccagtacatgacggctacacagagatgcttccc
ccaaggcgagcccaaagacgtgctggcgtcataatgcatccgacatctctgcccggacat
tatggtataggtgatttggggaaggaagcttttgcattcatcgactggctcgcggatgca
aagatgcaggtctggcagatcttgccactggttcctcctgggagaccgatacctgggttt
agagaagactattggtctccttattccggccgcgatgctcactgtggaaacactctgata
atctctttggatgaacttgtggcggacggccttttgacagaacaagagctcccacaaccc
tacaacctatcaggaaacgtagatttcagtcgtgtagccgaaataaacgagcctttaata
gcacgagcagcgaagcgcctcctcgagagatcagatgatgactcgttgaagtcttctctc
gcgacttggcgttctcggcccgagataaaatcctggatcgaagaagctgctctgtttgat
gcgatatgcaacgatccaaatcttgttggtaaagactggtgggattggcctgaagatctt
cggcgccgagatccggccaagctcgaacaaaagcgcgcttcagcggctgcgcacatcgaa
gaattttgcgccacgcagtttttatttgataagcagtggcttaaattaaagacgtatgca
aattctcaaggaatatctatcattggagacatgccaatatatgtcggtggccactctgct
gatgtctgggctaatcagtcactattccttctcggggatgattttaagccgacctcagta
gcaggcgttcccccagacgcattcagtgaagatgggcagctttggggtaatcctttgtac
gattggaggtcccactctcaggaaaactaccgttggtgggcgggtcgaatcggaagagct
ttgcagctgcacgatgaagtgcgcatcgaccattttcgagcgtttgccgcatactggtcc
gtgcctgccagtgcaaaaacagccaaaaatggttcttggatagtaggccccggcaaatca
tttttcgatggtgtcgaaaaagtagttggcgatgctccgattgtcgctgaagaccttggt
gtcatcaccaaagacgttgttgacctgcgcgaggcaattgaggctcctggtatggttgtg
cttcagtttgcatggggcggggataagcaaagtcctcatctccctcacaatttctgtgag
aattccttctgctaccctgggactcatgacaaccaaacaacagaaggctggtatgagaac
ttagacgaagcaacgaaggtgaagttggcaaattacgcaggcatatcagacgccgagggc
gctgcctggggactgattcgtctaggtatgtcaagcgtcagcaaagcttgcgtgttcacg
atgcaagacgtactgggcctgggtgatgaagcgaggatgaacacgccaggtgtggcagat
ggcaattgggcatggcgaatcggcccccctggtatctttgcaacatgcagccctcaagct
aaaaagctggccagccttgcaacatgtttcgatcgcgtatctccggaacatatgattaac
aaaaaaaacatcgaggttgagtcccccaaagcaaatgatgatgtcacgccagatggtgat
ggcagtgatgctaatagaccctgcaggcagaaattttttggcgtgttttga

DBGET integrated database retrieval system