KEGG   Micromonas sp. RCC299: MICPUN_90107Help
Entry
MICPUN_90107      CDS       T02695                                 

Definition
alanine aminotransferase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
mis  Micromonas sp. RCC299
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICPUN_90107
   01210 2-Oxocarboxylic acid metabolism
    MICPUN_90107
   01230 Biosynthesis of amino acids
    MICPUN_90107
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUN_90107
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MICPUN_90107
Enzymes [BR:mis01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MICPUN_90107
Amino acid related enzymes [BR:mis01007]
 Aminotransferase (transaminase)
  Class I
   MICPUN_90107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(411514..412905)
Genome map
AA seq 463 aa AA seqDB search
MEYAVRGAIVTRAGELEAQLKKDPASLPFDKIVMCNIGNPQSVGQKPITFYRQVLALTDY
PQLMDAPEAGKLFPSDVISTAKHILGNMKGGTGAYSESKGVAALRQMVADGIEARDGGHK
CDIEDLWLTDGASVACHHIMKTLIRDGNDAVMVPIPQYPLYSASLALYGGTLVPYYLDED
KEWGLDVADLKVQLDKARAAGKEVRALCVINPGNPTGNALNVDNQKEIVQFCKDEGVLLI
ADEVYQENVYAEGRSFTSFKKVVRDMGLDIPLVSMQSTSKGFYGECGRRGGYMEVCGLDP
DVKAELYKLASVGLCPNLSGQVLMGLVMSPPKPGDPSYELYAAERDAILSSLKRRALKLV
SGLNALEGVTCNEAQGAMYAFPKVSLPEKFVAEATASGKMAPDALYCMKLLEATGIVVVP
GSGFGQVEGTWHFRTTFLPSEEDIGGVVEKLAKFHAEFMDTYR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagtacgccgttcgcggcgccatcgtgaccagggccggggagctcgaggcgcagctc
aagaaggacccggcgtccttacccttcgataagatcgtcatgtgcaacatcggcaacccg
cagagcgtcggccagaagcccatcacgttttaccgccaggtgctcgcgctcacggactac
ccccagctcatggacgcgcccgaggctgggaagctctttccctccgacgtcatctccacg
gccaaacacatcctagggaacatgaagggcggcaccggcgcctactcagagtccaagggg
gtcgccgcgctccgccagatggtcgctgacggcatcgaggcaagggatggggggcacaag
tgcgacatcgaggacctctggctcaccgacggcgcctccgtcgcgtgccaccacatcatg
aaaaccctgattcgcgacggcaacgatgcggtcatggttcccatcccccagtacccgctc
tactccgcctcgctcgctctgtacggcggcaccctcgtgccctattacctcgacgaggac
aaagagtggggcctcgacgtcgccgacctcaaggtgcagctggacaaggccagggcggcg
ggtaaggaggtccgcgcgctgtgcgtgatcaacccgggcaaccccaccggcaacgccctg
aacgtcgacaaccagaaggagattgtgcagttttgcaaggacgagggggtgctcctcatc
gcggatgaggtgtaccaggagaatgtctacgcggagggcaggtcgttcacgtccttcaag
aaggttgtccgcgacatgggcctcgacatccccctggtctccatgcagtcaacgtctaag
ggcttctacggcgagtgcgggcggcgcggggggtacatggaggtgtgcggcctcgaccct
gacgtcaaggctgagctgtacaagctcgcgtccgtcgggctgtgccccaacctcagcggc
caggtcctcatgggcctcgtgatgtccccacccaagcccggggacccatcctacgagctc
tacgccgcggaacgcgacgcgatcctctcgtcgctcaagcgcagggcgctcaagctcgtc
tcgggtctcaacgcgctggagggcgtgacctgcaacgaggcgcagggtgcgatgtacgcg
tttcccaaggtttccctcccggagaagttcgtggctgaggcgacggccagcggcaagatg
gcgcccgacgcgctgtactgcatgaagctactcgaggccacgggaatcgtggtggtgccc
ggaagcgggttcggccaggtggagggcacctggcacttccgcaccaccttcctcccgtca
gaggaggacattggcggcgtcgtcgagaagctcgccaagtttcacgccgagttcatggac
acgtacaggtga

DBGET integrated database retrieval system