KEGG   Micromonas commoda: MICPUN_93204Help
Entry
MICPUN_93204      CDS       T02695                                 

Definition
(RefSeq) predicted protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mis  Micromonas commoda
Brite
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MICPUN_93204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 8250221
NCBI-ProteinID: XP_002507692
JGI: MicpuN3_93204
UniProt: C1FEE9
Position
1:complement(1548478..1550532)
Genome map
AA seq 684 aa AA seqDB search
MFLPPTLSDFITIASSFLFIVSSLILLFLKTDRRRRKHSNPPRRSPSDDVATARSPEAKL
RVAVYYGTQTGTSARLARELEEATLHRYGKQVHVRLMDLEQVTTERAEVIFTRGHEPLAI
FLQSTYGDGEPTDSSLEFIHWLRDQADDGRLPELLKGLTFCVFGLGNSSYEQFNAAGKCV
DHSLKSLGAARLMKLHLGDDDYDLEGDFRRWKEALWASIEDTYGIHANDGIDQVSINPAY
CVSTVSHENALEAEKRTRDAMSKCPRDGFATQQSPFAASVILARELHNVTSTRSCVHIEF
DISDSGITYQPGDHLGVFAENSLAVIQRAAACLHLPLDHSFSLSVPEGSPVSLPQPFSSP
CTLATALAKYTDLLSPPRKGALEALASVSTDKVECERLKRLASTDGKNEYEAFIGSPKRS
LLEVLESFPSAVPPLGLFFGAIGPRLSPRYYSISSSPRCKSNVVSATVAVVSTTTPTGRL
HEGVASSYLARFVSRANKTDVVNSAMKETRVPLFVRSSTFKLPRDPIAPIVMIGPGTGFA
PFRGFLQEREALLRAGNTLGPAYLFFGCRHEDQDFIYRDEMEGALQKNVISVLQVAFSRS
NSSHKVYVQDKLASVAKDLHGIMKGTIGANKGRIYVCGDAKGMARDVHRALHVILMNLGG
YAAHEAEGIVKRLAESGRYQKDVW
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaccgccgacactctctgatttcattacgatcgcgtcgtcctttctgtttatc
gtgtcttccttgatcctcctcttcctgaaaacagatcggaggcgaaggaaacactcgaac
ccccctaggcgatccccaagtgatgacgttgccaccgcgcgatcacctgaggccaagttg
cgtgtcgcggtatactatggaacccaaacagggacatcagcgagattggctcgtgaacta
gaagaagcaactcttcacagatatggcaaacaagtgcacgtgcggctgatggacctcgag
caagtgaccacagagagggcggaggtgatttttactcgagggcacgagccccttgcaatc
tttctccagtctacatacggggacggggagcccacagattcttcccttgagttcatccat
tggctccgtgatcaagctgacgatggccgccttccggaacttcttaagggactcacattc
tgtgtttttggactaggaaacagctcgtacgagcaatttaacgctgccggaaaatgcgtt
gatcattcattgaaatctctgggagcagcgcggctaatgaaactccatctcggcgatgat
gactatgaccttgaaggagattttcggcgatggaaagaggcactttgggcttcaatcgaa
gatacatacggtattcatgccaacgatggcatagaccaagtgagcatcaatccagcgtac
tgtgtatcaacagtttcacatgaaaatgctctagaggcagagaagcgaacaagagatgca
atgtcaaaatgtccaagggacggattcgccactcaacaatcaccctttgcagcttccgta
atcctcgcacgcgagcttcataatgtaacttcgactcgaagttgtgttcacattgaattc
gatattagcgattcaggtataacataccagcctggggatcatcttggtgtgtttgcagaa
aactctctggcggtgattcagcgggcagctgcgtgtttgcacctccccctcgaccactca
ttcagtctaagtgtcccggagggaagccccgtgtctcttccacagccattttcgagtccg
tgtactttagccactgctcttgccaaatacactgacctcctcagtccacctcggaaagga
gctttagaagcgcttgcatcagtatcgactgataaggtcgaatgtgagcgtctcaaacgt
cttgcatcaacagatgggaaaaatgaatatgaagcgttcatagggtctccgaagcgcagt
ttgcttgaagttcttgagtcatttccatctgcagtcccacccctcggattgttttttgga
gctatcggtccacgcctatcacctcgatactattcaatatcttctagcccacgatgcaaa
tccaatgttgtatcagcaactgttgcagtagtatcaacaacaacgcctactgggcgactt
catgaaggggttgcatcatcatacctcgcaaggtttgtttcccgcgccaataaaactgat
gttgtgaactcagcgatgaaggaaacgcgcgttccgttgtttgttcgctcgagtacgttc
aaactccctcgagatccgatcgcgccaatcgtcatgattggcccgggaacaggatttgca
ccgtttaggggatttctgcaagagcgagaagcacttttaagagcaggaaatactcttggt
cccgcgtacttgttttttggttgtcggcacgaggatcaagattttatctacagagatgaa
atggaaggcgctcttcagaaaaatgttatttcagtcctgcaagttgcattcagccgatcc
aattcttcacacaaagtgtatgttcaagacaaacttgcaagtgtggcgaaggatttacat
ggtatcatgaagggcacaatcggagctaacaagggcagaatatatgtatgcggagatgca
aaagggatggcaagggatgtccaccgcgcactccatgtgattttgatgaatttaggtgga
tatgctgcacacgaagcagaaggtatcgtgaaacgactggccgagtctggacgataccag
aaggatgtttggtga

DBGET integrated database retrieval system