KEGG   Micromonas sp. RCC299: MICPUN_93204Help
Entry
MICPUN_93204      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MICPUN_93204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1548478..1550532)
Genome map
AA seq 684 aa AA seqDB search
MFLPPTLSDFITIASSFLFIVSSLILLFLKTDRRRRKHSNPPRRSPSDDVATARSPEAKL
RVAVYYGTQTGTSARLARELEEATLHRYGKQVHVRLMDLEQVTTERAEVIFTRGHEPLAI
FLQSTYGDGEPTDSSLEFIHWLRDQADDGRLPELLKGLTFCVFGLGNSSYEQFNAAGKCV
DHSLKSLGAARLMKLHLGDDDYDLEGDFRRWKEALWASIEDTYGIHANDGIDQVSINPAY
CVSTVSHENALEAEKRTRDAMSKCPRDGFATQQSPFAASVILARELHNVTSTRSCVHIEF
DISDSGITYQPGDHLGVFAENSLAVIQRAAACLHLPLDHSFSLSVPEGSPVSLPQPFSSP
CTLATALAKYTDLLSPPRKGALEALASVSTDKVECERLKRLASTDGKNEYEAFIGSPKRS
LLEVLESFPSAVPPLGLFFGAIGPRLSPRYYSISSSPRCKSNVVSATVAVVSTTTPTGRL
HEGVASSYLARFVSRANKTDVVNSAMKETRVPLFVRSSTFKLPRDPIAPIVMIGPGTGFA
PFRGFLQEREALLRAGNTLGPAYLFFGCRHEDQDFIYRDEMEGALQKNVISVLQVAFSRS
NSSHKVYVQDKLASVAKDLHGIMKGTIGANKGRIYVCGDAKGMARDVHRALHVILMNLGG
YAAHEAEGIVKRLAESGRYQKDVW
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgtttctaccgccgacactctctgatttcattacgatcgcgtcgtcctttctgtttatc
gtgtcttccttgatcctcctcttcctgaaaacagatcggaggcgaaggaaacactcgaac
ccccctaggcgatccccaagtgatgacgttgccaccgcgcgatcacctgaggccaagttg
cgtgtcgcggtatactatggaacccaaacagggacatcagcgagattggctcgtgaacta
gaagaagcaactcttcacagatatggcaaacaagtgcacgtgcggctgatggacctcgag
caagtgaccacagagagggcggaggtgatttttactcgagggcacgagccccttgcaatc
tttctccagtctacatacggggacggggagcccacagattcttcccttgagttcatccat
tggctccgtgatcaagctgacgatggccgccttccggaacttcttaagggactcacattc
tgtgtttttggactaggaaacagctcgtacgagcaatttaacgctgccggaaaatgcgtt
gatcattcattgaaatctctgggagcagcgcggctaatgaaactccatctcggcgatgat
gactatgaccttgaaggagattttcggcgatggaaagaggcactttgggcttcaatcgaa
gatacatacggtattcatgccaacgatggcatagaccaagtgagcatcaatccagcgtac
tgtgtatcaacagtttcacatgaaaatgctctagaggcagagaagcgaacaagagatgca
atgtcaaaatgtccaagggacggattcgccactcaacaatcaccctttgcagcttccgta
atcctcgcacgcgagcttcataatgtaacttcgactcgaagttgtgttcacattgaattc
gatattagcgattcaggtataacataccagcctggggatcatcttggtgtgtttgcagaa
aactctctggcggtgattcagcgggcagctgcgtgtttgcacctccccctcgaccactca
ttcagtctaagtgtcccggagggaagccccgtgtctcttccacagccattttcgagtccg
tgtactttagccactgctcttgccaaatacactgacctcctcagtccacctcggaaagga
gctttagaagcgcttgcatcagtatcgactgataaggtcgaatgtgagcgtctcaaacgt
cttgcatcaacagatgggaaaaatgaatatgaagcgttcatagggtctccgaagcgcagt
ttgcttgaagttcttgagtcatttccatctgcagtcccacccctcggattgttttttgga
gctatcggtccacgcctatcacctcgatactattcaatatcttctagcccacgatgcaaa
tccaatgttgtatcagcaactgttgcagtagtatcaacaacaacgcctactgggcgactt
catgaaggggttgcatcatcatacctcgcaaggtttgtttcccgcgccaataaaactgat
gttgtgaactcagcgatgaaggaaacgcgcgttccgttgtttgttcgctcgagtacgttc
aaactccctcgagatccgatcgcgccaatcgtcatgattggcccgggaacaggatttgca
ccgtttaggggatttctgcaagagcgagaagcacttttaagagcaggaaatactcttggt
cccgcgtacttgttttttggttgtcggcacgaggatcaagattttatctacagagatgaa
atggaaggcgctcttcagaaaaatgttatttcagtcctgcaagttgcattcagccgatcc
aattcttcacacaaagtgtatgttcaagacaaacttgcaagtgtggcgaaggatttacat
ggtatcatgaagggcacaatcggagctaacaagggcagaatatatgtatgcggagatgca
aaagggatggcaagggatgtccaccgcgcactccatgtgattttgatgaatttaggtgga
tatgctgcacacgaagcagaaggtatcgtgaaacgactggccgagtctggacgataccag
aaggatgtttggtga

DBGET integrated database retrieval system