KEGG   Micromonas sp. RCC299: MICPUN_96665Help
Entry
MICPUN_96665      CDS       T02695                                 

Gene name
BAM2
Definition
glycoside hydrolase family 14 protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mis00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11:complement(join(840933..841320,841651..841848,842047..842858))
Genome map
AA seq 465 aa AA seqDB search
MGSPRSSGGVPVYVMLPLDTVSRDGQLQRPDELAERMSRLKRAGVEGVMVDVWWGIVERD
GPLLYDWAAYLDLAGLANRIGLRLHAVLSFHSCGANRDDDYHVPLPRWVTDAVARDPDGL
LFADRAGTKSDEYLSLWADEAPMMIMDGTAEAARMEHAPPRTPLECYRDFMVSFKGAFAE
ILGSVVTEVLVGCGPCGELRYPAYAASRGWEFPGVGEFQCYDRRALESLRAAAVNAGRPE
WGAAGPHDAGTYNSHPDDTGFFSNGKGRIRSPNGRWDSDYGRFFLGWYSQELVAHGDRVM
GAAADVFNGTGARLALKCAGIHWWYRTRSHAAELTTGGGNGVPGYDGIMAMCRRRGVGVT
FTCAEMSDGEHPPEMRCGPEGLLRQVVAAADRHGVEISAENALYRCDSGAYKQMVRNSMG
LSGDGGGGMHSFTFLRLCDSLMEPDNFAQFETFVRDMSGDSAGGR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgccacggagctccgggggcgtgccggtttacgtgatgctcccgctcgatacg
gtctcgagggacgggcagctccagcggccggatgagctcgccgagcgcatgtctcgcctg
aagcgcgcgggggtcgaaggggtgatggtggacgtctggtggggcatcgtcgagagggac
ggcccgctactctacgactgggccgcgtacctcgacctcgccgggttggcgaatcggatc
ggcctcaggctgcacgcggtgctctcctttcactcatgcggcgcgaacagggacgacgac
taccacgtcccgctgccccgatgggtcaccgacgcggtggcgcgcgaccccgacggcctc
ctcttcgccgatcgcgcgggaaccaagagcgacgagtacctctcgctgtgggcggatgaa
gcgccgatgatgatcatggacggcaccgcggaagccgcacggatggaacacgcgcctccg
cggaccccgctggagtgctaccgcgacttcatggtctcgttcaagggggcgttcgccgag
atcttgggctcggtcgtcaccgaggtgctcgtgggatgcggtccttgcggcgagcttcgg
tacccggcgtacgcggcttcgcgcggatgggagtttcccggcgtgggcgagttccagtgc
tacgacaggcgcgcgctggagtcccttcgcgcggcggcggtcaacgcgggtaggccggag
tggggcgccgcgggtccccacgacgcggggacgtacaactcgcacccggacgacaccggc
ttcttctccaacggcaaaggaaggatccgttcgccgaacgggcggtgggacagcgactac
gggcggttcttcctcgggtggtactcgcaggagctggtggctcacggggatcgggtgatg
ggcgcggcggccgacgttttcaacggcacgggcgcgaggctggcgctcaagtgcgccggc
atccactggtggtaccgcacccggtcgcacgccgccgagctcaccacggggggcggcaac
ggcgtgcccggctacgacggcatcatggccatgtgccggcgtcgcggcgtcggcgtcacg
tttacgtgcgcggagatgagcgacggcgaacacccgccggagatgcgatgcgggcccgag
ggtttgctgcggcaggtcgtagccgccgcggacaggcacggggttgagatttcggcggag
aacgccctgtaccgctgcgacagcggggcttacaagcagatggttcggaatagcatgggt
ctgtccggcgacggcggcggcgggatgcactcgttcacgtttcttcgactgtgcgactcg
ctgatggagccggataattttgcacagttcgagacgttcgtgagggacatgagcggagat
agcgccgggggaaggtga

DBGET integrated database retrieval system