KEGG   Micromonas sp. RCC299: MICPUN_96728Help
Entry
MICPUN_96728      CDS       T02695                                 

Gene name
AMY1
Definition
glycoside hydrolase family 13 protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mis  Micromonas sp. RCC299
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mis00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14:complement(join(28619..29419,29476..30018))
Genome map
AA seq 447 aa AA seqDB search
MVPDIAATGVTHLWLPPPSHSVSPEGYLPRHLWNLDSSEYGDQNELVALNASLREAGIMP
VCDVVINHRTADEIGPEGVYNVYSDEVDHTGTAVHWGRHMITCNDPAFHGSGHEDSGDNY
DAAPDLDHANDELRATLKRWLRWLRWDVGFGGFRFDFVRGYAPEYTEEYVKETTSRGDFC
VGENWVDLAWEGSHLNYNQDGPRGKLVEWLAATHGTCALFDFPTKGILQRAVTHVEFYRL
RDPASRPPGLSGWIPSRAVTFVDNHDTGAPQNHWPFPPDRIALGYAYVLTHPGIPCVFGP
HLWGDDPVLSGVIRLLIDLRKRCCVCADAPVKIQMAENDIYVAKVGHRLTVKLGPRYEMP
VELIPKEPEWSLAVAGEDYAVWERVQYDTDADAKVVAMEREMMDVGDDGEYYPLERVPVD
NSRQSIGSWIEPPPGIVEPSDGEADPR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgacatcgccgccaccggggtgacacacctctggctgcccccaccgtcgcac
tccgtctcacccgaggggtacctccccaggcacctgtggaacttggattcgagcgagtac
ggcgaccaaaacgaactcgtggctctcaacgcgtcgcttcgcgaggctggaatcatgccc
gtgtgcgacgtcgtcatcaaccaccgcaccgcggacgagatcgggccggagggggtgtac
aacgtgtacagcgacgaggtggaccacacgggcaccgccgtgcactggggccggcacatg
atcacctgcaacgacccggcgttccacgggagcggccacgaggactcgggcgataactac
gacgccgcgccggacctggaccacgccaacgacgagctgcgcgccaccctgaagcgatgg
ctcaggtggctacgctgggacgtcgggttcggcgggttcaggttcgatttcgtccgcggg
tacgcgccggagtacaccgaggagtacgtcaaggagacgacgtcgcgaggggacttttgc
gtgggggaaaattgggtcgacctcgcgtgggagggctcccacctcaactacaaccaggac
ggacccaggggcaagctcgtggagtggctcgccgccacgcacggcacgtgcgcgctcttc
gactttcccacgaaaggaatcctgcagcgcgcggtgactcacgtcgagttttaccggctc
agggacccggcgtcgagacctccgggcctctccggatggattccaagtagggccgtcacg
ttcgtggacaaccacgacaccggcgcgccccagaaccactggccgttccctcccgacagg
atcgccctcgggtacgcctacgtcctgacccacccggggataccgtgcgtgttcggtccg
cacctgtggggcgacgacccggtgctctccggcgtgatcaggctcctgatcgaccttcgc
aagaggtgctgcgtgtgcgccgacgcgcctgttaagatccagatggccgaaaacgacatc
tacgtggcaaaggtgggacacaggctgacggtcaagctaggaccgaggtacgagatgccc
gtggagctcatcccgaaggagcccgagtggtccctcgccgtggctggcgaggactacgcc
gtctgggagcgggtccagtacgacaccgacgcggacgcgaaagtcgtcgccatggagcgc
gagatgatggacgtcggggacgacggggagtactacccgctcgagcgcgtgcccgtggac
aactcccgccagtccatcggaagctggatcgaaccgccgcccgggatcgtcgagccgtcc
gacggcgaggcggacccgcgctga

DBGET integrated database retrieval system