KEGG   Micromonas sp. RCC299: MICPUN_97179Help
Entry
MICPUN_97179      CDS       T02695                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MICPUN_97179
Protein kinases [BR:mis01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MICPUN_97179
Exosome [BR:mis04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MICPUN_97179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1154123..1155076,1155259..1155387))
Genome map
AA seq 360 aa AA seqDB search
MIWRSLFEIDMKYVPIKPIGKGAYGVVCSAKDSETGEKVAIKKIANAFDNATDARRTLRE
IKLLRRLQHENIVLLKDIMRPPSKDDFNDVYLVYELMDTDLHQILRSSQGLSDEHCQYFL
YQILRGLKYVHTAQVLHRDLKPSNLLLNANCDLKICDFGLARTSSERGFMTEYVVTRWYR
APELLLSCEDYTSAIDIWSMGCILAEILGRKPLFPGKDYIHQMRLIVEVLGSPNEEDCAF
IQSTKARNYIRTLPHSPQVRWERMFPKGNPQAIDLLDKMLQFDPKKRITVEQALEHPYLT
ALHDPMVEPASEPAPFEFEFEDEELQEEQLREKVWEEMLSFHGEGSFGRGRGSGVTPMMS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgatatggcgcagccttttcgagatcgacatgaagtacgttcccatcaaaccgatcggc
aagggtgcctacggcgtggtgtgctccgcgaaggactcggagactggcgagaaggtggca
attaagaagatcgccaacgccttcgacaatgcgacggacgccaggaggacactccgtgag
atcaagctcctgcgccgtttgcagcacgagaacatcgtgctgctcaaggacatcatgcgt
ccgccctctaaggatgacttcaacgatgtctacctggtgtacgagctgatggacaccgac
cttcaccagatcctgcgatcctcccagggcctcagcgacgagcactgccagtatttcctg
taccagatcctgcgtgggctgaagtatgttcacaccgcgcaggtgctgcaccgcgatctg
aagcccagcaatctgcttttgaacgcaaactgcgacctaaaaatatgcgactttggcctg
gcgaggacgtcgtcggagagggggttcatgacggagtatgtggtcacacggtggtatcgg
gcgccagagcttcttctgagctgcgaggattacacaagcgcgattgatatctggtcgatg
gggtgcatcctggccgagattctcggcaggaagcccctcttcccggggaaagactacatt
catcagatgcgtctgatagtcgaggtgcttggctcgccgaacgaggaggactgcgcgttc
atccagtccaccaaggcacgaaattacatccgcacgctgcctcacagtccgcaggttcga
tgggagcgaatgtttccaaaggggaacccccaggcgatcgacctgctggacaagatgctc
cagttcgatcccaaaaaacgtataaccgtggagcaggccctggagcacccttacctgacc
gccctgcacgatccaatggttgagcctgcgtcggagccggcgccgtttgagtttgagttt
gaggatgaggagctgcaagaggagcagcttcgtgaaaaggtttgggaggagatgctgagc
ttccacggcgagggcagcttcgggaggggaagaggatcgggggttacaccgatgatgagt
tga

DBGET integrated database retrieval system