KEGG   Micromonas sp. RCC299: MICPUN_98056Help
Entry
MICPUN_98056      CDS       T02695                                 

Definition
histone acetyltransferase
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mis  Micromonas sp. RCC299
Brite
Enzymes [BR:mis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MICPUN_98056
Transcription factors [BR:mis03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    MICPUN_98056
Mitochondrial biogenesis [BR:mis03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    MICPUN_98056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
11:join(433381..433710,433882..436743)
Genome map
AA seq 1063 aa AA seqDB search
MMMGNGGGSGNMMMANGAPVLRGAAANGATFMGGGMGNQQQQQQHQMMMMQQQQQMQMQQ
PPADQKPGGKQKKLTAAQQKKLAEQMKKQQQQQMMMMQQQQMQGGDGQGRDGKPMTEEEI
KKAYIVKQQRWLLFLRHASKCQAAEGQCQYTPHCHVAKSLWEHVLKCTNSQCQYPRCLAS
RELLKHHQNCKDARCPVCGPVRSAMLKQRSQMLMQQQQQTGGPNAKRMRTDGQFMPVGPP
VAQVKGSVGQKRPGGEGTSLMECFTPDEVRTHLASLRLSETANPVAKGQPMSARRRDAEA
EKAIAGASESACQGCGVERLTFEPPPLYCYACVGRIKRGQVYYHIPPSATGGEVRKDAWC
NGCYNAIQGHVELEGQKWPKNVLAKKKNDDDLEEPWVQCDYCNSWYHQICVLFNGRRNEG
GEAPFTCPQCILSQLEKKERTPTTKRPSSQLPASILPQTKLSFFLEERLRKVLGRERQER
AKLLGKPVDEVPHAEGLTIRVVSSVEKKLDTKSNFMRVFKDQKFPESFPYRSKVLLLFQK
IEGVDVCLLGIYVQEYGSECPAPNTRRVYLSYLDSVKYFRPSGIQVATGEGCALRTYCYH
QILIGYLQYVKQRGFTSCFIWACPPFQGEDYILYCHPKEQKTPKSDKLREWYLKMLRQAQ
KEGIVLSLGNLYDEFHLGNQNHDIASATELPYFDGDYFPGVAEDWIPGIEKEQAENAKKN
KGKKPAPQSKTRGKKLPNAEVGDDLDVELAKKLGATIQNMRHDFIMAHLAHQCTQCRKCI
ADDNRWYDSTPSDKGTVFELCQECYDVESALPAHDKVLTKGRDLVCERVEALVEKTGDDV
EEMQSEFFDTRQAFLSLCQGNHFQFDSLRRAKHTTMMVLYHLNNPSEPAFVATCNVCQRE
LEPGKGWRCETCPDYDICEECKISVGHEHALVRSGQRHSGAAGGMTEEDRRDRQAQIQRT
MELLVHATTCKLANCGSPNCTKVKHLFKHAMSCTMKAGGGCQLCRKMWTLLQVHSKGCKA
TNCPVPRCRDLKEYRRRATEQIEERRREQYRMYINQQNAAMGR
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggggaacggcggcgggtctgggaacatgatgatggccaacggcgctccggtg
cttcgcggcgcggcggcgaacggcgccacgttcatgggcggcggcatgggcaaccagcag
cagcagcagcagcatcagatgatgatgatgcagcagcagcagcagatgcagatgcagcag
ccgcccgcggatcagaagcccggggggaagcaaaagaagctcaccgccgcgcagcagaag
aagctcgccgagcagatgaagaagcagcaacagcagcagatgatgatgatgcagcagcag
cagatgcaggggggcgacggtcaagggcgggacggcaaacccatgacagaggaggagatc
aagaaggcgtacatcgtcaagcagcagcgatggctcctcttcctccgccacgcgtccaag
tgccaggcggcggagggccagtgccagtacactccccactgccacgtcgcaaagtcgctc
tgggagcacgtcctgaagtgcacgaattcccagtgccagtacccgcggtgcctcgcctca
cgcgaactcctgaagcatcaccagaactgcaaggatgcccgctgccccgtgtgcggcccc
gtgcggtccgccatgctcaagcagcgatcgcagatgctcatgcagcagcagcagcagacg
ggcggtcccaacgccaagcggatgcgaaccgacgggcagttcatgcccgtcggcccgccc
gtcgcgcaggtcaagggcagcgtcggccagaagcgtccgggcggcgagggtacctcgctg
atggagtgcttcacccccgacgaggttcgcacgcacctcgcgtctcttcgcctgtcggag
acggctaacccggtggcgaagggtcagccgatgagcgccaggcgaagagacgcggaggct
gagaaggccatcgcgggcgcgtcggagagcgcgtgccagggctgcggcgtggagcggctc
acgtttgagcccccgccgctgtactgctacgcgtgcgtgggtcggatcaagcgcggacag
gtgtattaccacatcccgccatccgcgacgggcggcgaggttcgcaaggatgcctggtgc
aacgggtgctacaacgcgatccaggggcacgtggagctcgagggccagaagtggcccaag
aacgtcctcgccaagaagaagaacgacgacgacctcgaggaaccctgggtgcagtgcgac
tactgcaacagctggtaccaccagatttgcgtgctcttcaacgggcggcgcaacgagggc
ggcgaggctccgttcacgtgcccgcagtgcatcctctcgcagctcgagaagaaggagcgc
acgcccacgaccaagcgcccgagctcgcagctccccgcctccattctgccccagacaaag
ctctcgttcttcctcgaggagcgccttcgcaaggttctgggtcgcgaacggcaggagcgg
gccaagctcctcggcaagcccgtcgacgaggttccccacgcggagggtctcaccattcgc
gtcgtgtcctcagtggaaaagaagctggacaccaagtccaatttcatgcgcgtgttcaag
gaccagaagttccccgagtcgttcccgtacagatccaaggttctcctgctcttccagaag
attgagggcgtggacgtgtgcctcttgggcatctacgtccaagagtacggcagcgagtgc
ccggcgcccaacacccgccgcgtgtacctctcctacctcgactctgtcaaatacttcagg
ccgtccggcatccaggtggccaccggcgagggctgcgcgcttcgcacctactgctaccac
cagattctcatcggatacctgcagtacgtgaagcagcgtgggttcacctcgtgtttcatc
tgggcgtgccccccattccagggcgaggactacatcctctactgccaccccaaggagcag
aagacgcccaagagcgacaagctgcgcgagtggtacctcaagatgctccggcaagcgcag
aaggaggggatcgttctctcgctgggtaacctgtacgacgagtttcacctggggaaccag
aaccacgacatcgcgtcggcgactgagcttccgtactttgacggcgactacttccccggc
gtcgcggaggattggatcccgggcatcgagaaggagcaggctgagaacgcgaagaagaac
aagggcaagaaacccgcgccgcagagcaagacgcgcgggaagaagctgcccaacgcggag
gttggcgacgacctggacgtcgagctggccaagaagctgggcgcgacgattcagaacatg
cgacacgacttcatcatggcgcacctcgcgcaccagtgcacccagtgccgcaagtgcatc
gccgacgacaaccgctggtacgacagcacgccgtccgacaaggggaccgtgttcgagctc
tgccaggagtgctacgacgtcgagtctgcgcttcccgcgcacgacaaggttctcaccaag
ggtcgcgacctcgtgtgcgagcgggtggaggcgcttgtcgaaaagacgggggacgacgtc
gaggagatgcagtcggagtttttcgacacccgccaggcgttcctgtccctgtgccagggc
aaccacttccagttcgactcgttgcgcagggcgaagcacaccacgatgatggtgctgtac
cacctgaacaacccgagcgagccggcgtttgtggcgacgtgcaacgtgtgccagcgcgag
ctggagcccgggaaggggtggcggtgcgagacgtgcccggattacgacatctgcgaggag
tgcaagatctcggtgggccacgagcacgcgttggtgcgcagcgggcagaggcacagcggt
gcggctggcggcatgacggaggaggacaggcgcgaccgccaggcgcagattcagcgcacg
atggagctcctggtgcacgcgacgacgtgcaagctggccaactgcggctcgcccaactgc
accaaggtgaagcacctgttcaaacacgcgatgtcgtgcacgatgaaggctggcggcggg
tgccagctgtgccgcaagatgtggacgctgctgcaagtgcacagcaaggggtgcaaggcg
accaactgcccggtgcctcggtgcagggatctcaaggagtatcgcaggagggcgacggag
cagatcgaggagcgcaggcgcgagcagtaccgcatgtacatcaaccagcagaacgccgcg
atgggccgttaa

DBGET integrated database retrieval system