KEGG   Mycobacterium intracellulare MOTT-02: OCO_02830Help
Entry
OCO_02830         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCO_02830
Enzymes [BR:mit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     OCO_02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288261..289265
Genome map
AA seq 334 aa AA seqDB search
MTFSAARAVARWITPFLTITAVTGIGLVCDPVLVRPAPTVRLASDGNPLDGAPFYVNPTS
AAMRAAQSADPPSAELTAIANTPQAYWIVPGGSAATVGKYVGDAAAAGAIPVLAIYGIPH
RDCGSFAAGGMGSGADYRSWIDGIAGGVGTSRVAIIVEPDALAMADCLSGDQRQERFDLV
HYAVDTLTKDPNAAVYIDAGHLRWHSAEDMAARLNQAGVGHARGFSVNTANFFTTEDEIG
YGEAISGLTNGSHYVIDTSRNGAGPAPDSELNWCNPSGRALGTPPTASTAGAHADAYLWI
KRPGESDGTCGKGDPPAGHFVNQYAIDLAHNTGH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgacgttctcagctgctcgtgcagtcgcacgatggatcacccctttcctgacgatcacg
gccgtcaccggcatcggccttgtctgcgacccggtgctggtccgtcccgccccgacggtg
cgtttggcctccgatggcaacccactggacggggcgccgttctacgtcaaccccacgtcg
gcggccatgcgcgccgcccagagcgccgatccgccgagtgccgagttgaccgcgatcgcc
aatacgccgcaggcgtactggatcgtcccgggcggttccgcagcaacggtcgggaagtac
gtcggcgacgcggccgccgccggcgccatcccggtgctggcgatctacggaatcccccat
cgcgactgcggcagcttcgccgcgggcggcatggggtcgggcgccgactaccggagctgg
atcgacggcatcgccggcggagtgggcacctcgcgggtggcgatcatcgtcgaacccgat
gcgctcgccatggccgactgcctctcgggtgatcagcgccaagaacggttcgatctggtt
cattacgccgtcgacacgctgacgaaggatccgaacgcggccgtgtacatcgacgcgggt
cacctgcgttggcacagtgccgaggacatggccgccaggctgaatcaggccggcgtcggt
cacgcgcggggcttcagcgtcaacaccgcgaacttcttcaccaccgaggacgaaatcggt
tacggcgaagcgatttcgggactcaccaatggttcgcactacgtgatcgacacgtcgcgc
aacggtgccggaccggcgcctgattccgagctcaactggtgcaatcccagcggccgagcg
ttgggcaccccgcccaccgcctcgaccgcgggtgcgcacgccgacgcctacctgtggatc
aaacgtcccggcgaatccgacgggacgtgcggcaagggtgatccgccggcgggtcacttc
gtgaatcagtacgccatcgatctggcccacaacaccggccactag

DBGET integrated database retrieval system