KEGG   Mycobacterium intracellulare MOTT-02: OCO_03590Help
Entry
OCO_03590         CDS       T01754                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mit00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365741..366673
Genome map
AA seq 310 aa AA seqDB search
MAEFAEFVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSS
VLTSVLNRANLAPKNIAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALEAD
GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFAIPRAMLPRIGPSSSPQPYGVTAETGPA
GGEIAITGVLGDQHAAMVGQVCLAEGEAKKHLWHRQFPATEHRRDDRALRQRAAVHRLLP
VRGRQTRLRT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagttcgccgaattcgtggccgctatcgaccaggggacgaccagcacgcgctgc
atgatcttcgatcacgagggtgccgaggtggcccgccaccagctcgagcacgaacagatc
ctgccccaggcgggctgggtcgagcacgacccggtggagatctgggaacgtacctcctcg
gtgctgacctccgtgctcaaccgtgccaacctggcgccgaaaaacattgccgcgctgggt
atcacgaaccagcgcgagacgacgctggtctggaaccgcaagaccggacggccctattac
aacgcgatcgtctggcaggacacccgcaccgaccggatcgcgtcggcgctggaagccgac
ggccggggcgaggtgatccgccgcaaggcgggacttcccccggcgacgtacttctccggc
gcaaagctgcgatggatcttggagaatgtcgacggggtgcgcgacgccgccgagcgtggc
gacgcgttgttcggcaccccggacacctgggtgttgtggaacctgaccgggggtccgcgg
ggcggcgtgcacgtcaccgacgtgaccaacgccagccggaccatgctgatgaacctcgag
accctggactgggacgacgagttgctgtcattctttgcgatcccgcgcgcgatgctgccg
cggatcgggccgtcgtcgtcgccgcagccctacggggtgacggccgagaccggcccggcg
ggcggagagattgcgatcacgggcgtgctgggtgaccagcacgcggcgatggtggggcag
gtgtgtctggccgagggggaggcgaaaaaacacctatggcaccggcaatttcctgctact
gaacaccggcgagacgatcgtgcgctccgacaacgggctgctgtccaccgtctgctacca
gttcggggacgccaaacccgtttacgcacttga

DBGET integrated database retrieval system