KEGG   Mycobacterium intracellulare MOTT-02: OCO_03590Help
Entry
OCO_03590         CDS       T01754                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    OCO_03590
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     OCO_03590
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCO_03590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365741..366673
Genome map
AA seq 310 aa AA seqDB search
MAEFAEFVAAIDQGTTSTRCMIFDHEGAEVARHQLEHEQILPQAGWVEHDPVEIWERTSS
VLTSVLNRANLAPKNIAALGITNQRETTLVWNRKTGRPYYNAIVWQDTRTDRIASALEAD
GRGEVIRRKAGLPPATYFSGAKLRWILENVDGVRDAAERGDALFGTPDTWVLWNLTGGPR
GGVHVTDVTNASRTMLMNLETLDWDDELLSFFAIPRAMLPRIGPSSSPQPYGVTAETGPA
GGEIAITGVLGDQHAAMVGQVCLAEGEAKKHLWHRQFPATEHRRDDRALRQRAAVHRLLP
VRGRQTRLRT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttggccgagttcgccgaattcgtggccgctatcgaccaggggacgaccagcacgcgctgc
atgatcttcgatcacgagggtgccgaggtggcccgccaccagctcgagcacgaacagatc
ctgccccaggcgggctgggtcgagcacgacccggtggagatctgggaacgtacctcctcg
gtgctgacctccgtgctcaaccgtgccaacctggcgccgaaaaacattgccgcgctgggt
atcacgaaccagcgcgagacgacgctggtctggaaccgcaagaccggacggccctattac
aacgcgatcgtctggcaggacacccgcaccgaccggatcgcgtcggcgctggaagccgac
ggccggggcgaggtgatccgccgcaaggcgggacttcccccggcgacgtacttctccggc
gcaaagctgcgatggatcttggagaatgtcgacggggtgcgcgacgccgccgagcgtggc
gacgcgttgttcggcaccccggacacctgggtgttgtggaacctgaccgggggtccgcgg
ggcggcgtgcacgtcaccgacgtgaccaacgccagccggaccatgctgatgaacctcgag
accctggactgggacgacgagttgctgtcattctttgcgatcccgcgcgcgatgctgccg
cggatcgggccgtcgtcgtcgccgcagccctacggggtgacggccgagaccggcccggcg
ggcggagagattgcgatcacgggcgtgctgggtgaccagcacgcggcgatggtggggcag
gtgtgtctggccgagggggaggcgaaaaaacacctatggcaccggcaatttcctgctact
gaacaccggcgagacgatcgtgcgctccgacaacgggctgctgtccaccgtctgctacca
gttcggggacgccaaacccgtttacgcacttga

DBGET integrated database retrieval system