KEGG   Mycobacterium intracellulare MOTT-02: OCO_04570Help
Entry
OCO_04570         CDS       T01754                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mit00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457337..457939
Genome map
AA seq 200 aa AA seqDB search
MALPDTAMSKMRVFDQDRAEAAVRELLCAIGEDPDRHGLRETPARVARAYREMFAGLYTD
PDSVLNTMFDEDHDELVLVKEIPLYSTCEHHLVSFHGVAHVGYIPGNDGRVTGLSKIARL
VDLYAKRPQVQERLTSQIADALVKKLNPRGVIVVVEAEHLCMAMRGVRKPGATTTTSAVR
GIFKTNAASRAEALDLILRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcactgccggacaccgcgatgtccaagatgcgggtcttcgaccaggaccgtgccgag
gccgcggtccgcgagttgctgtgcgcgatcggcgaagacccggaccggcacggcctgcgg
gaaaccccggcccgcgtcgcccgcgcctaccgggagatgttcgccgggctctacaccgat
ccggacagcgtgttgaacaccatgttcgacgaggatcacgacgagctggtgctggtcaag
gaaatcccgctgtactccacgtgcgaacaccacctggtgtcgttccacggggtggcccac
gtcggctacatcccgggcaacgacggcagggtcaccggcctgtcgaagatcgcgcgactg
gtcgatctgtacgccaagcggccccaggtgcaggaacggctcaccagccaaatcgccgac
gccctggtgaaaaagctcaatccgcgcggggtgatcgtcgtggtcgaggccgagcacctg
tgcatggcgatgcgcggtgtccgcaagcccggagcgacgaccacgacctcggcggtgcgc
ggaatattcaaaaccaacgccgcttctcgagccgaggcgctcgacctcatcctgcggaag
tga

DBGET integrated database retrieval system