KEGG   Mycobacterium intracellulare MOTT-02: OCO_04600Help
Entry
OCO_04600         CDS       T01754                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OCO_04600
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     OCO_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459243..459752
Genome map
AA seq 169 aa AA seqDB search
MVLSIGSNLGDRLARLQSVVDGLGDTVLAVSPVYETDPWGRVDQAPFLNAVLIADDPACD
GQGWLARAQEFERAAGRVRGERWGPRTLDVDLIACYGQTEVTSRENNLTLPHPLAHLRAF
VLIPWLAVDPDARLTVAEGPRPVAQLLAELEPADRAAVRRSDLTLELTT
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttgtccatcgggtccaacctgggggaccggctggcgcggttgcagtcggtcgtc
gacgggctgggggacacggtgctcgccgtgtcaccggtgtacgagaccgacccttggggc
cgggtcgatcaggcgccgttcctcaacgcggtgctgatcgccgacgacccggcctgcgac
gggcagggctggctggcccgggcgcaggagttcgagcgcgcggcgggcagggtccgcggc
gagcgctgggggccgcgcaccctcgacgtcgacctgatcgcctgttacgggcaaaccgag
gtgacctcgcgggagaacaacctgacgctgccgcatccgctggcccatttgcgggccttc
gtgctgatcccctggctggccgtcgacccggacgctcggctgacggtcgccgaagggccg
cgtcccgtcgcgcagttgctggccgaactggagcccgccgaccgtgccgccgtacggcgc
tccgacctgacgctcgagctcacaacctga

DBGET integrated database retrieval system