KEGG   Mycobacterium intracellulare MOTT-02: OCO_04800Help
Entry
OCO_04800         CDS       T01754                                 

Definition
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC:2.7.7.60)
Orthology
K00991  
2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCO_04800
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     OCO_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478735..479424
Genome map
AA seq 229 aa AA seqDB search
MARQTGTSGNVIAVVPAAGSGERLAAGIPKAFCEIAGRTLLERAVAGLLESGVVDHVVVA
VPADRIDEAKRVLAGRATVVAGGPDRTRSVDLALAALPVAAAYVLVHDAARALTPPTLIT
RVVDALRAGHDAVVPALRLHDTIKVVDANGVVLGTPERDGLRAVQTPQGFATDLLQRAYR
AGAGAAGFTDDASLVERVGGQVQVVDGDPLAFKITTQLDLLLAEAIVRR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgacagacgggcacctcgggcaacgtaatcgccgtcgtcccggccgcaggttcg
ggcgaacgactggcggcgggaatccccaaggcattctgcgagattgccggccgcaccctg
ctggagcgcgccgtcgcggggctgttggaatccggcgtggtcgatcacgtcgtggtggcc
gtgcccgccgaccggatcgacgaggccaagcgcgtcctcgccgggcgggccaccgtcgtc
gccggcgggcccgaccgcacccgatccgtcgacctggccttggccgccctccccgtggcc
gccgcgtacgtgctggtgcacgacgcggcgcgcgcgctgacccctccgacgctgatcacc
cgcgtggtcgacgccctgcgggccggccacgacgccgtggtgcccgcgttgcggctgcac
gacaccatcaaggtcgtggacgccaacggggtggtcctggggacgccggagcgcgacggg
ctacgggcggtgcagacgccccaggggttcgccaccgacctgctgcagcgcgcctaccgg
gccggcgccggcgcggccggtttcaccgatgacgcgtcgctggtcgagcgcgtcggcggg
caggtccaggtggtcgacggcgatccgctggcgttcaagatcaccacccagctcgatttg
ttgctggccgaagcgatcgtgcgccgatga

DBGET integrated database retrieval system