KEGG   Mycobacterium intracellulare MOTT-02: OCO_09430Help
Entry
OCO_09430         CDS       T01754                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCO_09430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCO_09430
   00640 Propanoate metabolism
    OCO_09430
   00660 C5-Branched dibasic acid metabolism
    OCO_09430
Enzymes [BR:mit01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     OCO_09430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
928022..929185
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDTAEGAREIATEIGRPVMVKAQVKVGGRGKAGGVK
YAATPDDAYEHAKNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLATARSIAEQGHLPAEVLDAAAVTINKLWEVF
VAEDATLVEVNPLVRDPKDQILALDGKVTLDANADFRQPGHAEFEDRDATDPLELKAKEH
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILNDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDGNNVDEGRRIL
AQANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaccttttcgagtatcaagcaaaagaattgttcgccaagcacaacgtaccgactacg
ccgggacgcgtgaccgacaccgccgagggcgcccgcgagatcgccaccgagatcggccgt
ccggtgatggtcaaggcgcaggtgaaggtcggcgggcgcggcaaggccggcggcgtcaag
tacgcggcgacgcccgacgacgcctacgagcacgccaagaacatcctcggtctcgacatc
aagggacacgtcgtcaagaagctgctggtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctggaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggaaatcgaggaggtcgccgcgaccaagccggagcggctggccaaggttccg
gtggacgccgtcaagggtgtcgacctggcgaccgcgcgttccatcgccgagcagggccac
ctgcccgccgaggtgctggacgccgccgccgtcaccatcaacaagctgtgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtcaacccgctggtgcgcgaccccaaagaccaa
atccttgcgctggacggcaaggtcaccctcgacgccaacgccgacttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccaccgacccgctggagctcaaggccaaggagcac
gacctcaactacgtcaagctggacggctcggtcggcatcatcggcaacggcgcgggcctg
gtgatgtccacgctggacgtcgtcgcctacgcgggagagaagcacggcggggtcaagccg
gccaacttcctggacatcggtggtggcgcgtcggccgaggtgatggccgccggtctggac
gtcatcctgaacgacaagcaggtcaagagcgtcttcgtgaacgtgttcggtggcatcacc
tcctgcgacgccgtcgccaacgggatcgtgaccgcgctgaacatgctcggcgacgaggcg
aacaagccgctcgtggtccggctcgacggcaacaacgtcgacgaaggccggcgcatcctg
gcccaagccaaccacccgctggtgatccaggccgagaccatggacgccggtgccgacaaa
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system