KEGG   Mycobacterium intracellulare MOTT-02: OCO_09740Help
Entry
OCO_09740         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OCO_09740
   00052 Galactose metabolism
    OCO_09740
   00500 Starch and sucrose metabolism
    OCO_09740
   00520 Amino sugar and nucleotide sugar metabolism
    OCO_09740
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OCO_09740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
959449..960321
Genome map
AA seq 290 aa AA seqDB search
MPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVIITSEGKDGVVAHF
VEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIGCVESRLSDDEDAI
AVLLPDDLVLPTGVLGTMSKVRAHHGGTVLCAIEVTPEEISAYGVFDVEPVPDDENPDVL
RVKSMVEKPKAEDAPSLFAAAGRYVLDRAIFDALRRTERGAGGEVQLTDGIALLIAEGHP
VHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLAEQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgccgccggtctcggtacccgcttcttgccggcaaccaaaacggtgcccaaggaa
ctgctgccggtggtcgataccccgggcatagagctggtggccgccgaggcggccgaagcc
ggtgccgaacggctggtgatcatcacctccgagggcaaggacggcgtcgtcgcgcatttc
gtcgaagacctcgtactggaaagcacgctggaggagcgcggcaaaaccgcgatgctcgac
aaggtccgccgcgcgccgcgactgatcaaggtcgagtccgtcgtgcagagcgaaccgctg
gggctcggccatgcgatcgggtgcgtggaatcgcggctgtccgacgacgaggacgcgatc
gcggtgctgctgcccgacgacctggtgttgccgaccggcgtgctgggcacgatgtcgaag
gtgcgagcccaccacggcggcaccgtgttgtgcgcgatcgaggtcacccccgaagagatc
agcgcctacggcgttttcgacgtcgagccggtgcccgacgatgagaaccccgacgtgctg
cgggtcaagagcatggtcgagaagcccaaggccgaggacgcgccgtcgctgttcgccgcg
gcgggccgatatgtgctcgaccgcgccatctttgacgcgttgcgccgcaccgagcgcggg
gccggcggcgaagtgcaactcaccgacggcatcgccctgctgatcgcggagggccacccg
gtgcatgtggtcgtgcaccgcggatctcgacacgacttgggaaatcctggcggctacctc
aaggctgcggttgactttgcattggatcgtgacgactacggcccggatttgcggcaatgg
ttggtggcgcgattgggcctggccgagcagtag

DBGET integrated database retrieval system