KEGG   Mycobacterium intracellulare MOTT-02: OCO_13380Help
Entry
OCO_13380         CDS       T01754                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00071  Fatty acid degradation
mit00280  Valine, leucine and isoleucine degradation
mit00281  Geraniol degradation
mit00310  Lysine degradation
mit00360  Phenylalanine metabolism
mit00362  Benzoate degradation
mit00380  Tryptophan metabolism
mit00410  beta-Alanine metabolism
mit00627  Aminobenzoate degradation
mit00640  Propanoate metabolism
mit00650  Butanoate metabolism
mit00903  Limonene and pinene degradation
mit00930  Caprolactam degradation
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01212  Fatty acid metabolism
Module
mit_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCO_13380
   00650 Butanoate metabolism
    OCO_13380
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_13380
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_13380
   00310 Lysine degradation
    OCO_13380
   00360 Phenylalanine metabolism
    OCO_13380
   00380 Tryptophan metabolism
    OCO_13380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCO_13380
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCO_13380
   00281 Geraniol degradation
    OCO_13380
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_13380
   00627 Aminobenzoate degradation
    OCO_13380
   00930 Caprolactam degradation
    OCO_13380
Enzymes [BR:mit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCO_13380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFC47701
Position
1351215..1352024
Genome map
AA seq 269 aa AA seqDB search
MTTSEIATLPGYEEFAPWLLVEKTGNVHVISINRPEAFNAVNEDVHHAFATIWRVLAADD
DVRAVVTTGVGKAFSAGGDMVMFGRLIEDPVARQFQITEARTVFLEVINFPKPLVSAVNG
PAVGLGCSIALLSDFLVMGENSYLADPHVAVGLVAGDGGAAMLPLLIGLMKAKEYVLLGD
RITPAIADKLNLVTKVATDDTVLDEALAIGERLAGLPPQALRASKVAMNMHLSRAALGVL
EYALAEEYTSFSTPEFKERVAAFRARSKK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttccgagatcgccaccctgcccggctacgaagagtttgcgccgtggctgctg
gtggagaagaccggcaacgtgcacgtgatcagcatcaaccggccggaggctttcaacgcc
gtcaacgaggacgtgcaccacgcgttcgcgacgatctggcgggtactggccgccgacgat
gacgtgcgggcggtggtgacaaccggtgtcggaaaggcattttccgcgggcggcgacatg
gtgatgttcgggcgcctcatcgaggacccagtggcacgtcagtttcagatcaccgaggcc
cgcacggtttttcttgaggtgatcaatttccccaagccgctggtgtcggccgtcaacggc
ccggctgtcgggctcggctgctcgatcgctttgttgagcgacttcctggtgatgggggag
aacagctacctggccgacccgcatgtcgcggtcggcttggtggccggtgacggcggtgcc
gcgatgcttccgctgctgatcggcctgatgaaagccaaagagtatgtgctgctgggggat
cggatcacccctgccattgcggacaagctgaacctcgtcaccaaagtggccaccgatgac
accgtgctcgacgaggcgctcgcaataggagagcggctggccggtctgccgcctcaggcc
ctgcgcgccagcaaggtcgcgatgaacatgcacctgtctcgggccgcgctcggtgtgctg
gagtacgcgctggccgaggaatacacgtcgttctcgaccccggaattcaaggagcgggtg
gccgcgttccgggcgcgctcgaagaagtag

DBGET integrated database retrieval system