KEGG   Mycobacterium intracellulare MOTT-02: OCO_13650Help
Entry
OCO_13650         CDS       T01754                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCO_13650
   00630 Glyoxylate and dicarboxylate metabolism
    OCO_13650
   00640 Propanoate metabolism
    OCO_13650
   00650 Butanoate metabolism
    OCO_13650
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_13650
   00072 Synthesis and degradation of ketone bodies
    OCO_13650
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_13650
   00310 Lysine degradation
    OCO_13650
   00380 Tryptophan metabolism
    OCO_13650
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    OCO_13650
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_13650
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCO_13650
Enzymes [BR:mit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     OCO_13650
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCO_13650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1378366..1379553)
Genome map
AA seq 395 aa AA seqDB search
MATTTSRAAIVAAARTPIGTARKGTLANMPAIELAKPVVQAVVERSGLDAADFDDLVLAE
SMQGGGDSARYIAVALGMLDIPGLAVNRQCASSLSAIAVGAGQIASGMSRAILAGGMESL
STGPIMQKRKLFTAGKSPEDYAQWFPESHPPTAEAPAMDMSITVAHNCNLQYGITREDQD
KWALRSHQRAIRAIDTGAFTDEIIPLQVPQADGSVITFAEDEHPRRGSSMESLAGLKVLH
PEIEGFTVTAGNSSGINDAAAVVALASPDTQQEVLASVLSWTQVGLDPTRTGSGPIKAIP
KALELAGRKLEDVALFEINEAFAAQAVACARELGLDEEIVNVYGSGISLGHPIAATGARM
VTSAIYELRRRGGGIGVLSMCAGGGMGAAMVIEVA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccacgtcccgcgcagcgatcgtggccgctgcccgcacaccgatcggaacg
gcgcgcaagggcacgctggccaacatgcccgcgatcgagctcgccaaacccgtcgtgcag
gccgtcgtcgaacgctccggactggacgcggcggacttcgacgacctggtgctggccgag
agcatgcagggcggcggcgacagtgcccgctacatcgcggtggccctcggcatgctcgac
attcccgggctcgccgtgaaccgccagtgcgcatcgagtctttcggccatcgccgtgggc
gccgggcagatcgcgtccgggatgagccgcgccatcctggccggcggtatggagtcgctg
tcgaccggcccaatcatgcagaagcgcaagctcttcaccgcaggcaagtcgcccgaggac
tacgcgcagtggttccccgagtcgcatccgccgactgcggaagcgcccgccatggacatg
tccatcaccgtcgcgcacaactgcaaccttcagtacgggatcacccgcgaggaccaggac
aagtgggcgctgcgcagccatcagcgcgcgatcagggccatcgacaccggggcgttcacc
gacgagatcatcccgctccaggtgccccaggccgacggcagcgtgattaccttcgccgag
gacgagcatccacggcgcgggagttcgatggagtcgcttgccgggctgaaggtgctgcat
cctgagatcgaaggcttcaccgtgacggcaggaaactcctccgggatcaacgatgccgcg
gcagtggtcgcgctggccagcccggacacccagcaggaagtgctggcaagcgtgctgtcc
tggacacaggtcggactggacccgacgcggaccggcagcgggccgatcaaagctatcccg
aaggcgctcgagttggcgggccgcaagctcgaggatgttgcactattcgaaatcaacgag
gcgttcgccgctcaggcggtggcgtgtgcgcgcgaactcggtctcgacgaggagatcgtc
aacgtctacggctcgggcatcagcctgggccacccgatcgccgcaaccggcgcccgcatg
gtcacctcggcgatctacgaattgcgcaggcgcggtgggggtatcggcgtgctgtcaatg
tgcgccggcggtggtatgggtgccgcgatggtcattgaggtggcctga

DBGET integrated database retrieval system