KEGG   Mycobacterium intracellulare MOTT-02: OCO_14620Help
Entry
OCO_14620         CDS       T01754                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00360  Phenylalanine metabolism
mit00362  Benzoate degradation
mit00620  Pyruvate metabolism
mit00621  Dioxin degradation
mit00622  Xylene degradation
mit00650  Butanoate metabolism
mit01100  Metabolic pathways
mit01120  Microbial metabolism in diverse environments
mit01220  Degradation of aromatic compounds
Module
mit_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCO_14620
   00650 Butanoate metabolism
    OCO_14620
  Amino acid metabolism
   00360 Phenylalanine metabolism
    OCO_14620
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_14620
   00622 Xylene degradation
    OCO_14620
   00621 Dioxin degradation
    OCO_14620
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OCO_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFC47825
Position
complement(1473110..1474042)
Genome map
AA seq 310 aa AA seqDB search
MPSKSSIAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVD
WLLAQSEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRAHLDAP
NVNMITCGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSR
GVETIGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVATYVPG
YRLLNEPQFDDPSIHSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKES
LSATAGGAQS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctaagtcgtccatcgccattgtcgggtcggggaacatcagcactgacctgctt
tacaaactgctgcgttcggactggctggaaccgcgctggatggtcggcattgacccggag
agcgagggtttggcccgggcccgcaagctgggtctggagaccacccacgagggtgtggac
tggctgttggcccagtccgagaagcccgacctggtgttcgaggcgaccagcgcctacgtg
caccgcgacgcggcccccaagtacgaggccgccggcatccgggccatcgacctgaccccg
gccgcggtgggccccgcggtgatcccgccggccaacctgcgcgcgcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccaccatcccgatcgtctacgcggtgtcg
cgcgccgtcgccgacctcggcggcgtgccgtacgccgagatcgtcgcctcggtcgcctcg
ctgtcggccggccccggcacccgcgccaacatcgacgagttcaccaagaccaccagccgg
ggtgtggagaccatcggcggcgccaagcgtggcaaggcgatcatcatcttgaatccggcg
gacccgccgatgatcatgcgcgacaccatcttctgcgccatcccggaggacgccgaccgg
gacgcgatcgccaagtcgattcacgacgtggtggccgaggtggcgacctacgtgccgggt
taccggctgctcaacgagccccagttcgatgacccgtcgatccactccgggggccaggca
ctggtcaccacgttcgtcgaagtggagggtgcgggcgactatctgccgccttacgctgga
aatctcgacatcatgaccgccgcggccaccaaagtcggcgaggagatcgccaaggagtcc
ttgagcgcgacggccggaggagcgcaatcatga

DBGET integrated database retrieval system