KEGG   Mycobacterium intracellulare MOTT-02: OCO_15740Help
Entry
OCO_15740         CDS       T01754                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00260  Glycine, serine and threonine metabolism
mit00750  Vitamin B6 metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01230  Biosynthesis of amino acids
Module
mit_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OCO_15740
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OCO_15740
Enzymes [BR:mit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OCO_15740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFC47937
Position
1583477..1584559
Genome map
AA seq 360 aa AA seqDB search
MSAPRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIAATRLSEKTGCTVHLKVE
GLNPTGSFKDRGMTMAVTDAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDALGAAPDVHALPVGNAGNITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVNGAPV
KNPETIATAIRIGAPASWTAAVDAQRQSNGRFLAATDEEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVDDGWVARGSTVVCTVTGNGLKDPDTALRDMPTVTALPVDPVLVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgcgcaccgccgtccaccagccctggcccgggctcatcgaggcctaccgg
gaccggttgccggtgggcgacgactggaccccggtcaccctgctcgagggcggcaccccg
ctgatcgcggcgacccgcctgtcggaaaagaccggctgcacagtccatctcaaggtcgag
ggcctcaatcccaccggctccttcaaagaccgggggatgacgatggcggtcaccgatgcg
gtggcgcgcggccaacaggccgtgttgtgcgcctcgaccggcaacacctcggcgtcggcg
gcggcctatgccgcccgcgccgggatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcgcaggcggtgatgcacggcgccaagatcatccagatcgacggc
aacttcgacgactgcctggaactggcccgaaagatggccgccgacttcccgacgatctcc
ttggtcaattcggtcaacccggtgcgcatcgagggccagaagacggccgcgttcgagatc
gtcgacgcgctcggcgcagcgccggacgtgcacgcccttccggtcggcaacgcgggcaac
atcaccgcgtactggaagggatacaccgagtatcaccacgagggcctgatcgaaaagctg
ccgcggatgctgggcacccaggcggccggcgcggcccccctggtgaacggtgcgccggtc
aagaacccggaaacgattgcgaccgcgatccgcatcggcgcgcccgcgtcgtggacggcc
gcggtcgacgcgcagcgccaatccaacggccgcttcctggcggccaccgacgaggagatc
ctggccgcctaccacctggtggccgagtccgaaggtgtcttcgtcgaacccgcctcggcg
gccagcatcgcgggtctgctcaaggccgtcgacgacggctgggtggcccgcgggtcgacg
gtcgtgtgcacggtgacgggcaacgggctcaaggatcccgacacggcactacgggatatg
cccaccgtgaccgcgctgccggttgatccggtcctggtcgtcgaaaaactggggctggcg
tag

DBGET integrated database retrieval system