KEGG   Mycobacterium intracellulare MOTT-02: OCO_16090Help
Entry
OCO_16090         CDS       T01754                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCO_16090
Enzymes [BR:mit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     OCO_16090
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   OCO_16090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1621551..1623746)
Genome map
AA seq 731 aa AA seqDB search
MSQADQLARTHLAPDPADLSRLVAGTHHNPHGVLGAHEYGDHTVIRAYRPHAVEVVAIVG
DDRFPMQHVESGLFAVALPFTNLIDYRLQITYEGADPYVVADAYRFLPTLGEVDLHLFAE
GRHERLWEVLGAHPRSFTTADGVVNGVSFAVWAPNAKGVSLIGEFNGWTGNDAPMRVLGS
SGVWELFWPGFPLEGLYKFRVHGADGVVTERADPMAFATEVPPHTASRVTRSKYTWEDAD
WMTQRAGRNPVFEPMSTYEVHLGSWRPGLNYRQLARELTDYVVEHGFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDEFRALVDALHQAGIGVLVDWVPAHFPKDAWALARFDGT
PLYEHSDPQRGEQLDWGTYVFDFGRREVRNFLVANALFWLEEFHIDGLRVDAVASMLYLD
YSRPEGGWTPNIYGGRENLEAVQFLQEMNATAHKSAPGIVTIAEESTSWPGVTRPTNLGG
LGFSMKWNMGWMHDTLDYISRDPIYRSYHHHEMTFSMLYAFSENYVLPISHDEVVHGKGT
LWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEERGLDWWQLDEQGF
SNGVLRMVRDINNIYRSRPALWSQDTVPDGYSWIDANDSGNNVLSFLRYGKDGSVMACVF
NFAGAEHGGYRLGLPSAGRWREVLNTDATVYNGSGVGNMGGVDATEDPWHGRPASAVLVL
PPTSALWLEPE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccgaccaactcgctcggacgcacctggcgcccgaccccgccgacctgtcg
cgcctggtcgccggcacgcaccacaacccgcacggcgtgctgggggcccacgaatacggc
gaccacaccgtcattcgggcgtaccggccccacgcggtcgaggtcgtcgcgatcgtcggc
gacgaccgattcccgatgcagcacgtcgagtccgggctgttcgccgtggcgctgccgttc
accaacctgatcgactatcggctccagatcacctacgagggcgccgacccctacgtcgtc
gccgacgcctaccgtttcctgcccaccctcggcgaggtcgaccttcatctattcgccgaa
gggcgccacgagcgcctctgggaagtccttggcgcgcatcctcgctcgttcaccacggcc
gacggcgtggtcaacggggtgtcgttcgcggtgtgggcgcccaacgccaagggcgtcagc
ctgatcggcgagttcaacggctggaccggcaacgacgccccgatgcgggtgttgggctcc
tcgggcgtgtgggagctgttctggcccggcttcccgctggaggggctgtacaagtttcgc
gttcatggcgccgacggagtggtcaccgaacgcgccgaccccatggccttcgccaccgag
gtgccgccgcacacggcctcccgggtgacgcgcagcaagtacacctgggaagacgcggac
tggatgacgcaacgcgccgggcgcaacccggtgttcgagccgatgagcacctacgaggtt
cacctgggttcatggcgacccgggctcaactaccgccagttggcccgcgagctgacggat
tacgttgtggagcacggattcacccacgtcgagctgctcccggtcgccgaacatcccttc
gccggatcctggggataccaggtgacgtcgtactacgccccgacgtcccggttcggcacc
ccggacgaattccgggccctggtcgacgccctgcaccaggccggtatcggcgtgctggtg
gactgggtgccggcacacttcccgaaggacgcgtgggcgctggcccgcttcgacggcacc
ccgctttacgaacattccgacccgcaacgcggcgaacaactcgactggggcacctacgtt
ttcgacttcggtcgccgtgaggtacgcaacttcctggtggccaacgccttgttctggctc
gaagaatttcacatcgatggactacgtgtggacgcggtcgcgtcgatgctgtacctggat
tactcccgccccgaaggcggctggacgccgaacatctacggcgggcgggagaacttggag
gcggtccagttcctgcaggagatgaacgccacggcgcacaagagcgccccgggcatcgtc
accatcgccgaggagtcgacctcctggcccggggtcacccggccgacaaaccttggcggc
ctgggcttttcaatgaagtggaacatgggctggatgcatgacacgctcgactacatcagc
cgcgatccgatctatcggagctatcaccaccacgagatgacgttctcgatgctctatgcg
ttcagcgagaactacgtgctgccgatcagccatgacgaggtggtccacggcaagggaacg
ctgtggggacgcatgccgggcaacaatcacgtcaaggcggctggcctgcgcagcctgctc
gcctaccagtgggcgcacccgggcaagcaattgctgttcatgggccaggaattcggccag
cgcgccgagtggtccgaagagcgcggtctggattggtggcagctcgacgagcagggattc
tccaacggcgtcctgcgcatggtgcgcgacatcaacaacatctaccgcagccgcccggcg
ctgtggagccaagacaccgtgcccgacggttactcctggatcgacgccaacgactcgggc
aacaacgtcttgagcttcctgcgttacggcaaggacggctcggtgatggcgtgcgtgttc
aatttcgccggtgccgagcacggcggctaccggctgggcctgccgtcggcggggcggtgg
cgcgaggtgctcaacaccgacgccaccgtctacaacggttcgggggtcgggaacatgggc
ggtgtcgatgccaccgaagacccgtggcacgggcgcccggcctcggcggtgctggtgttg
ccgcccacgtcggcgctgtggctggaaccggagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system