KEGG   Mycobacterium intracellulare MOTT-02: OCO_16630Help
Entry
OCO_16630         CDS       T01754                                 

Definition
hypothetical protein
Organism
mit  Mycobacterium intracellulare MOTT-02
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1681005..1682231)
Genome map
AA seq 408 aa AA seqDB search
MVKVMQGFRVLEVAQFTFVPAAGAILADWGADVIKVEHPARGDTQRGFVNMGGFQLNPDR
HPLIEHPNRGKRSVGIDVSTPGGQEVIYELAKSADVFLTNYMPAQRQKHKFDVEHIRAVN
PNIVYARGSAYGDKGAERDVGGYDGTAFWTRSGVGYALTPEELGGALGQGIPAFGDSIGG
MFIAGGISAALLHRERTGEALELDVSLLSTAWWAAGASVTQGMETGEVMRTPMPGSAAAS
VNPFLGNYLTSDGGTINLCIVSPTGYIRDTFEHLGIPEAADDPRFCDVLPLIQNADAAAE
LIAKAFAGKPFDYWRQHLKTMKGQWAPFQSLLDLADDEQAIANDMIVEVESNDGGAPFKV
VRGPVQFNHEPLVTTRAPQASEHTEIVLMELGMDWDRIAELKDSGAIA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggtaatgcagggctttcgggtcctcgaggttgcgcagttcacgttcgtcccc
gccgccggcgcgatcctcgccgactggggtgccgacgtcattaaggtcgagcatccggcg
cgcggcgatactcagcgtggcttcgtcaacatgggtggcttccagctcaatcccgaccgg
catccgctgatagagcatcccaatcggggcaagcgcagcgtcgggatcgacgtctccacg
ccgggcggtcaggaagtgatctacgaactggccaagtccgccgatgtgttcctgaccaac
tacatgcccgcgcagcggcagaagcacaagttcgacgtggagcacatccgcgcggtgaac
ccgaacatcgtgtatgcgcgcggctcggcctacggcgacaagggcgccgagcgtgacgtc
gggggctatgacgggacggcgttctggacgcgcagcggggtggggtacgcgctgaccccc
gaggagttgggcggtgcactgggacagggcattcccgcgttcggggactccattggcggc
atgttcatcgccggtggcatctcggccgcgctgctgcaccgcgagcggaccggcgaagcg
ctcgagctggacgtgtcgttgctgagcacggcgtggtgggcggcgggcgcgagcgtgacg
cagggcatggaaaccggcgaggtcatgcgcaccccgatgcccggatccgcggccgcatcg
gtgaatcccttcctgggcaattacttaacctccgatggcggcacgatcaacctgtgcatc
gtcagcccgacgggctacattcgcgacaccttcgagcacctcggcatccccgaggcggcc
gacgatccccgcttctgcgacgtgctgccgttgatccaaaacgccgacgctgccgccgag
ctgatcgcaaaggccttcgccggcaagcccttcgactactggcgacagcacctgaaaacg
atgaaaggccagtgggcgccgttccagagcctcctcgatctggccgacgacgagcaagcc
atcgccaacgacatgatcgtcgaagtcgagtccaacgatggcggtgcaccgttcaaggtc
gtccgcgggccggtgcagttcaaccacgaaccgctcgtcaccacccgggccccgcaagca
tccgagcacaccgaaatcgtcctgatggaactcgggatggactgggaccgcatcgccgaa
ctcaaagattcaggagccatcgcatga

DBGET integrated database retrieval system