KEGG   Mycobacterium intracellulare MOTT-02: OCO_19410Help
Entry
OCO_19410         CDS       T01754                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    OCO_19410
  Carbohydrate metabolism
   00640 Propanoate metabolism
    OCO_19410
   00650 Butanoate metabolism
    OCO_19410
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_19410
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCO_19410
   00310 Lysine degradation
    OCO_19410
   00360 Phenylalanine metabolism
    OCO_19410
   00380 Tryptophan metabolism
    OCO_19410
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OCO_19410
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    OCO_19410
   00281 Geraniol degradation
    OCO_19410
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    OCO_19410
   00627 Aminobenzoate degradation
    OCO_19410
   00930 Caprolactam degradation
    OCO_19410
Enzymes [BR:mit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     OCO_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1996037..1996945)
Genome map
AA seq 302 aa AA seqDB search
MSDYEFLKWETFDDGMIVRISLNRPDQRNAQNRGMLVELDEAFARAESDDNVRVVVLAGE
GPMFSSGHDIGSKQARAEFGPGPGQHPTVTINGGTRDGAERTMLQEWHYFFQNNLRWRNL
RKITIAQVHGDVFSAGLMLIWACDLIVGSEEVRFADVVGTRLGMCGMEYFGHPWEFGPRR
TKELMLTGDAIGIEEAYRLGMVSKIFRRDELAERTLELARRIAEVPTMAALLIKESVNQS
VDNMGFYNALQSCFALHQLNHSHWAQIREDKLPTAGEAQGVPNWRSAPPVVLAVKDQVRS
SV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattacgaattcttgaagtgggagaccttcgacgacggcatgatcgttcggatc
tcgctgaaccgccccgaccagcgcaacgcccaaaaccgcggcatgctggtcgaactcgac
gaggcgtttgcccgcgccgaatccgatgacaacgtccgcgtcgtcgtcttggccggcgag
ggcccgatgttttcgtcgggccacgatatcggctccaagcaggcgcgtgccgagttcggc
cccgggcccggccagcaccccaccgtgaccatcaacggcggtacgcgcgatggagcggag
cggaccatgctgcaggaatggcactatttctttcaaaacaacctgcgctggcgcaaccta
cgaaagatcaccatcgcccaggtgcacggcgacgtgttctcggcgggactcatgctgatc
tgggcctgtgacctcatcgtgggcagcgaagaggtgcgcttcgccgatgtggtaggcacg
cggctgggcatgtgcggcatggaatacttcggccatccctgggaattcggaccgcggcgc
acgaaggagctcatgctcaccggtgacgcgatcgggatcgaagaggcctaccggctcggc
atggtgagcaagatcttccggcgcgacgaactggccgagcgcactctcgagttggcgcga
cgcatcgcggaggtgcccacgatggcggccctgctcatcaaagagtcggtaaaccaatca
gtcgacaacatgggtttttacaacgcgctgcagtcgtgtttcgcgttgcaccaattgaat
cactcgcactgggcccagatccgggaggacaagctccccaccgccggcgaggcgcaaggg
gtgccgaactggcggagcgctcccccggttgtcttggccgtgaaagatcaggtccggtcc
agcgtctaa

DBGET integrated database retrieval system