KEGG   Mycobacterium intracellulare MOTT-02: OCO_20860Help
Entry
OCO_20860         CDS       T01754                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    OCO_20860
Enzymes [BR:mit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     OCO_20860
Transfer RNA biogenesis [BR:mit03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    OCO_20860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2168806..2169546
Genome map
AA seq 246 aa AA seqDB search
MEAPMNDHDLAARLATDAGQLLLGVRQEFADAEANERKAAGDKRSHDFLMAALAAQRPGD
AVLSEEGADNPVRLRAERVWIVDPLDGTREFSELGRDDWAVHVALWEAGELVAGAVALPA
QGITFATPDIASPPAAPGKPRIVVSRTRPPAIALNVRDALDGVLVEMGSAGAKVASIVQG
LSDVYVHAGGQYEWDSAAPVAVARAAGLHTSRIDGSALAYNQPDPKLPDLVVCRPELAEA
VLAVTG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtggaggcgccgatgaatgaccatgacctggccgcgcggttggccaccgacgcgggccag
ctgctgctcggggtccggcaggagttcgccgacgcggaagcgaacgaacggaaagccgcg
ggggacaagcgatcccacgactttctgatggctgcgctcgccgcgcagcgccccggcgac
gcggtgctgtccgaggagggcgccgacaacccggtgcggttgcgcgcggagcgcgtctgg
atcgtcgatccgctggacgggacgcgggagttctccgagctcgggcgcgacgactgggcg
gtgcacgtcgcgttgtgggaggccggcgagctggttgccggcgccgtggcgctgccggcg
cagggcatcacgttcgccacgcccgacatcgcgtcgcctccggcggcgccgggcaagccg
cggatcgtggtctcgcgcacccgcccgcccgccatcgcgctgaacgtccgggacgcgctg
gacggcgttctggtcgaaatgggttcggccggcgccaaggtggcgtcgatcgtccagggc
ttgtccgatgtgtacgtgcacgccggcgggcagtatgaatgggactccgcggccccggtg
gcggtggcgcgcgccgcggggctgcacacctcccgcatcgacgggtccgctctggcctac
aaccagccggacccgaagctgccggacctcgtggtgtgtcgtcccgagctcgcggaggcc
gtactcgcggttaccggctga

DBGET integrated database retrieval system