KEGG   Mycobacterium intracellulare MOTT-02: OCO_21940Help
Entry
OCO_21940         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCO_21940
  Amino acid metabolism
   00340 Histidine metabolism
    OCO_21940
   00350 Tyrosine metabolism
    OCO_21940
   00360 Phenylalanine metabolism
    OCO_21940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCO_21940
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    OCO_21940
Enzymes [BR:mit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     OCO_21940
Amino acid related enzymes [BR:mit01007]
 Aminotransferase (transaminase)
  Class II
   OCO_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2276906..2277934
Genome map
AA seq 342 aa AA seqDB search
MASLNLSPPAARYHGDQAVAPGMLDFAVNVRHGQPPDWLLGRLAARLPDLARYPSVDDVR
AAQDAAAQRHGRARDEVLPLAGAAEAFALLGNLRPARAAIIAPAFTEPEAALRAAGVPVH
HVVLRPPFDLAGAVVPEDADLVVVGNPTNPTSVLHRREELLALRRPGRILVVDEAFADSI
PGEPESLAGDALPDVLVLRSLTKTWALAGLRVGYALGSPDVLARLTATRAHWPVGTLQLA
AIAACCAPQAVADAAAGAARLGRLRAEMVAGLASVGADVVDGRAPFVLFRMPEAVALRKR
LHDRGIAIRRCDTFVGLDEQYLRAAVRREWPLLVQAISEVRR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtctgaacctgagcccgcctgcggcgcgctatcacggcgatcaggccgtcgcg
cccgggatgctggacttcgccgtcaacgtccgtcacggccaaccgcccgactggctgctg
gggcggctggccgcgcggctgcccgacctggcgcgctacccgagcgtcgacgacgtccgc
gcggcgcaggacgcggccgcccagcggcacggccgggcccgcgacgaggtgctgccgctg
gccggggcggcggaggccttcgcgctgctgggcaacctgcgcccggcgcgggcggcgatc
atcgcgccggcattcaccgagccggaggcggcgctgcgtgccgccggagtgccggtgcac
cacgtggtgctgcggccgccgttcgacctcgcgggcgcggtggtccccgaggacgccgac
cttgtcgtcgtgggcaatcccaccaatcccacctcggtgctgcaccgccgcgaggagctg
ctcgcgttgcgccggcccggccggatcctggtggtcgacgaggccttcgcagactcgata
cccggggagcccgaatcgctggccggtgacgcgctgcccgacgtactggtgctgcgcagc
ttgacgaagacgtgggcgctggccgggctgcgggtgggctacgcgctggggtcgccggac
gtattggcgcggttgaccgccacgcgggcgcactggccggtgggcacgctgcagctggcg
gccatcgcggcgtgttgcgccccgcaggcggttgccgacgcggcggccggggcggcgcga
ctggggcggctgcgcgccgagatggtggccgggctggcgtcggtgggcgccgacgtggtc
gacggccgggcgccgttcgtgctgttccgcatgccggaggccgttgcattgcgaaaacga
ctgcatgacaggggaattgccatccgtcgctgtgatacgttcgtcggcttggacgagcag
tacctgcgggccgcggtgcgccgggagtggccgctgctggtgcaggcgatttcggaggtg
cgccggtga

DBGET integrated database retrieval system