KEGG   Mycobacterium intracellulare MOTT-02: OCO_21940Help
Entry
OCO_21940         CDS       T01754                                 

Definition
hypothetical protein
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mit01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mit00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mit00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mit00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mit00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:mit00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2276906..2277934
Genome map
AA seq 342 aa AA seqDB search
MASLNLSPPAARYHGDQAVAPGMLDFAVNVRHGQPPDWLLGRLAARLPDLARYPSVDDVR
AAQDAAAQRHGRARDEVLPLAGAAEAFALLGNLRPARAAIIAPAFTEPEAALRAAGVPVH
HVVLRPPFDLAGAVVPEDADLVVVGNPTNPTSVLHRREELLALRRPGRILVVDEAFADSI
PGEPESLAGDALPDVLVLRSLTKTWALAGLRVGYALGSPDVLARLTATRAHWPVGTLQLA
AIAACCAPQAVADAAAGAARLGRLRAEMVAGLASVGADVVDGRAPFVLFRMPEAVALRKR
LHDRGIAIRRCDTFVGLDEQYLRAAVRREWPLLVQAISEVRR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtctgaacctgagcccgcctgcggcgcgctatcacggcgatcaggccgtcgcg
cccgggatgctggacttcgccgtcaacgtccgtcacggccaaccgcccgactggctgctg
gggcggctggccgcgcggctgcccgacctggcgcgctacccgagcgtcgacgacgtccgc
gcggcgcaggacgcggccgcccagcggcacggccgggcccgcgacgaggtgctgccgctg
gccggggcggcggaggccttcgcgctgctgggcaacctgcgcccggcgcgggcggcgatc
atcgcgccggcattcaccgagccggaggcggcgctgcgtgccgccggagtgccggtgcac
cacgtggtgctgcggccgccgttcgacctcgcgggcgcggtggtccccgaggacgccgac
cttgtcgtcgtgggcaatcccaccaatcccacctcggtgctgcaccgccgcgaggagctg
ctcgcgttgcgccggcccggccggatcctggtggtcgacgaggccttcgcagactcgata
cccggggagcccgaatcgctggccggtgacgcgctgcccgacgtactggtgctgcgcagc
ttgacgaagacgtgggcgctggccgggctgcgggtgggctacgcgctggggtcgccggac
gtattggcgcggttgaccgccacgcgggcgcactggccggtgggcacgctgcagctggcg
gccatcgcggcgtgttgcgccccgcaggcggttgccgacgcggcggccggggcggcgcga
ctggggcggctgcgcgccgagatggtggccgggctggcgtcggtgggcgccgacgtggtc
gacggccgggcgccgttcgtgctgttccgcatgccggaggccgttgcattgcgaaaacga
ctgcatgacaggggaattgccatccgtcgctgtgatacgttcgtcggcttggacgagcag
tacctgcgggccgcggtgcgccgggagtggccgctgctggtgcaggcgatttcggaggtg
cgccggtga

DBGET integrated database retrieval system