KEGG   Mycobacterium intracellulare MOTT-02: OCO_21940Help
Entry
OCO_21940         CDS       T01754                                 

Definition
(RefSeq) hypothetical protein
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCO_21940
  Amino acid metabolism
   00340 Histidine metabolism
    OCO_21940
   00350 Tyrosine metabolism
    OCO_21940
   00360 Phenylalanine metabolism
    OCO_21940
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    OCO_21940
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    OCO_21940
Enzymes [BR:mit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     OCO_21940
Amino acid related enzymes [BR:mit01007]
 Aminotransferase (transaminase)
  Class II
   OCO_21940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
2276906..2277934
Genome map
AA seq 342 aa AA seqDB search
MASLNLSPPAARYHGDQAVAPGMLDFAVNVRHGQPPDWLLGRLAARLPDLARYPSVDDVR
AAQDAAAQRHGRARDEVLPLAGAAEAFALLGNLRPARAAIIAPAFTEPEAALRAAGVPVH
HVVLRPPFDLAGAVVPEDADLVVVGNPTNPTSVLHRREELLALRRPGRILVVDEAFADSI
PGEPESLAGDALPDVLVLRSLTKTWALAGLRVGYALGSPDVLARLTATRAHWPVGTLQLA
AIAACCAPQAVADAAAGAARLGRLRAEMVAGLASVGADVVDGRAPFVLFRMPEAVALRKR
LHDRGIAIRRCDTFVGLDEQYLRAAVRREWPLLVQAISEVRR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtctgaacctgagcccgcctgcggcgcgctatcacggcgatcaggccgtcgcg
cccgggatgctggacttcgccgtcaacgtccgtcacggccaaccgcccgactggctgctg
gggcggctggccgcgcggctgcccgacctggcgcgctacccgagcgtcgacgacgtccgc
gcggcgcaggacgcggccgcccagcggcacggccgggcccgcgacgaggtgctgccgctg
gccggggcggcggaggccttcgcgctgctgggcaacctgcgcccggcgcgggcggcgatc
atcgcgccggcattcaccgagccggaggcggcgctgcgtgccgccggagtgccggtgcac
cacgtggtgctgcggccgccgttcgacctcgcgggcgcggtggtccccgaggacgccgac
cttgtcgtcgtgggcaatcccaccaatcccacctcggtgctgcaccgccgcgaggagctg
ctcgcgttgcgccggcccggccggatcctggtggtcgacgaggccttcgcagactcgata
cccggggagcccgaatcgctggccggtgacgcgctgcccgacgtactggtgctgcgcagc
ttgacgaagacgtgggcgctggccgggctgcgggtgggctacgcgctggggtcgccggac
gtattggcgcggttgaccgccacgcgggcgcactggccggtgggcacgctgcagctggcg
gccatcgcggcgtgttgcgccccgcaggcggttgccgacgcggcggccggggcggcgcga
ctggggcggctgcgcgccgagatggtggccgggctggcgtcggtgggcgccgacgtggtc
gacggccgggcgccgttcgtgctgttccgcatgccggaggccgttgcattgcgaaaacga
ctgcatgacaggggaattgccatccgtcgctgtgatacgttcgtcggcttggacgagcag
tacctgcgggccgcggtgcgccgggagtggccgctgctggtgcaggcgatttcggaggtg
cgccggtga

DBGET integrated database retrieval system