KEGG   Mycobacterium intracellulare MOTT-02: OCO_22230Help
Entry
OCO_22230         CDS       T01754                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase (EC:2.3.1.12)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCO_22230
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OCO_22230
  Amino acid metabolism
   00310 Lysine degradation
    OCO_22230
Enzymes [BR:mit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     OCO_22230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2307195..2308988)
Genome map
AA seq 597 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKIV
AQEDDTVEVGGELAVIGDEDGGSQAPSQQEPQAQSAPPAQPEAQPEPEPQPQAQPEPQPA
QQSSGGGDATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVDTEIPSPVA
GVLISITAEEDATVPVGGELARIGSGSEAAAPAAPQPPPAPKAEPKPEPAPQPQPQPQPQ
PQAQPKPEPTPAPAPQPKAAPEPKAQPAQAQPADASGDGTPYVTPLVRKLAAENNIDLSS
VTGTGVGGRIRKQDVLAAAERKQQADKAPAAAAAPTPAAGEARKAAPAPAPAPALAHLRG
TTQKASRIRQITANKTRESLQATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLP
FIARAVIDALKIHPNVNASYNEETKEITYFDAEHLGFAVDTEQGLLSPVVHNAGDLSLAG
LARAIADIAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKR
PRVIVDEFGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggcgacacggtcgaactcgacgagccgctcgtcgaggtgtcg
accgacaaggtcgacaccgaaatcccgtcgccggccgcgggtgtgctgaccaagatcgtc
gcccaggaagacgacaccgtcgaggtcggcggcgagctggccgtgatcggcgacgaggac
ggcgggtcccaggcgccgagccagcaagagccgcaggcgcagtcggcgccccccgcgcaa
cccgaggcgcaacccgagcccgagccgcagccccaggcccagcccgagccgcagccggcc
cagcagagctccggcggcggcgacgccaccccggtgctgatgcccgaactgggtgagtcg
gtgaccgagggcaccgtgacccgctggctcaagaaggtcggcgattcggtccaggtcgac
gacgcgcttgtcgaggtgtccaccgacaaggtggacaccgagatcccgtcgccggtggcc
ggtgtgctgatcagcatcaccgccgaggaagacgccaccgtgcccgtcggcggcgagctg
gcccgcatcggcagcggttccgaggccgccgcccccgccgcgccgcagccgccgcccgcg
cccaaggccgaacccaagccggaacccgcgccacaaccgcaaccacaaccacagccccag
ccccaggcgcagccgaagcccgaaccgacgccggcccccgcaccgcaaccgaaggcggca
cccgagccgaaagcccaacccgcacaggcccagccggcggacgcaagcggcgacggcacc
ccctacgtgacgccgctggtgcgaaaactggccgccgagaacaacatcgacctcagttcg
gtcaccggcaccggagtgggcggccgcatccgcaagcaagacgtgctcgcggccgccgag
cgcaagcagcaggccgacaaggcgcccgccgccgccgctgctcccacccccgctgccggc
gaggcccgcaaggccgctcccgcgcccgccccggcgccggcgctggcgcacctgcgcggc
accacccagaaggccagccggatccgtcagatcaccgccaacaagacgcgcgaatccctg
caggccacagcccaactcacccagacccacgaggtcgacatgaccaggctggtcgggttg
cgggccagggccaaggcggcgttcgccgaacgcgaaggcgtcaacctgaccttcctgccg
ttcatcgcccgcgcggtgatcgacgccctcaagatccacccgaacgtgaacgcgagctac
aacgaggaaaccaaggagatcacctacttcgacgccgagcacctcggcttcgcggtcgac
accgaacagggtctgctctcccccgtcgtgcacaacgccggcgacctgtcgctggccggg
ctggccagggcgatcgccgacatcgccgcgcgcgcccgctcgggcaacctgaaacccgac
gagctctcgggcggcacgttcacgatcaccaacatcggcagccagggggcgctgttcgac
accccgatcctggtcccgccgcaggccgcgatgctgggcaccggcgccatcgtcaaacgc
ccccgggtgatcgtcgacgaattcggcaacgaatcgatcggtgtccgctcgatctgctac
ctgccgctgacctatgaccaccggctgatcgacggcgcggacgccgggcggttcctgacc
accatcaagcaccggctcgaagagggagcgttcgaggccgacctcgggctctga

DBGET integrated database retrieval system