KEGG   Mycobacterium intracellulare MOTT-02: OCO_22790Help
Entry
OCO_22790         CDS       T01754                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mit00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mit00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2365711..2367255
Genome map
AA seq 514 aa AA seqDB search
MSVPSALRPSAAAGVRLPALAADIGAAPAGDRAVPNLPVTGVTLRAQEVRPGDLFAALPG
STTHGARYAGDAIERGAVAVLTDAGGVAEMGALGQSVPILVHPDPRGVLGGLAATVYGNP
SERVTVVGVTGTSGKTTTTYLIESALRAAGRTAGLIGTIGIRIDGADIPSALTTPEAPAL
QAMLAAMAERGVDTVVMEVSSHALTLGRVDGTRFAVGGFTNLSRDHLDFHPTMADYFEAK
AMLFDPSSPLRARRAVVCVDDDAGRAMAARAGDAITVSAEGRPAHWRATDVAPMGAAGQR
FTAIDPAGARHQLGVRLPGHYNVANCLVALAILDAVGVSPEQASTGLLQARVPGRMEEID
AGQDFLALVDYAHKPGALRAVLTTLARPDHRLAVVFGAGGERDPGKRAPMGATAAELADL
VVVTDDNPRGEDPASIRREILAGATESGCAADIVEIADRRDAIRHAVAWAGPGDVVLIAG
KGHETGQSAGGHTRPFDDRVELAQALRDLNGAPR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtgcccagtgcgctgcggcccagcgccgcagcgggcgtgcgcttgccggcgttg
gcggctgacatcggagccgcgccggccggcgatcgggccgtcccgaacctgccggtcacc
ggggtcacgctgcgcgcccaggaggtgcggcccggcgatctgttcgccgcgctgcccggt
tccaccacccacggcgcgcgttacgccggcgacgcgatcgaacgcggcgcggtcgccgtg
ctcaccgacgccggcggggtcgccgagatgggcgccctagggcaatccgtgccgatcctc
gttcacccggacccccgcggcgtgctgggcgggctggccgccacggtgtacgggaacccg
tccgagcgggtgacggtcgtcggcgtcaccggcacgtccggcaagaccaccacgacgtat
ctcatcgagtccgcactgcgcgccgccggccgcaccgccgggctgatcggcaccatcggg
atccgcatcgacggcgccgacattcccagcgcgctgaccaccccggaggcccccgccctg
caggcaatgctggcggcgatggccgaacggggggtggacaccgtcgtcatggaggtctcc
agccacgccctgacgctgggccgcgtggacggaacccggttcgcggtgggcggtttcacc
aacctgtcccgcgaccacctcgacttccacccgacgatggccgactacttcgaggccaag
gcgatgctcttcgacccgagctccccgctgcgggcccggcgcgccgtcgtctgcgtcgac
gacgacgccgggcgcgccatggccgcccgcgccggcgacgcgatcaccgtcagcgccgag
ggccggcccgcccactggcgcgccaccgacgtggccccgatgggcgccgcgggacaacgg
ttcaccgccatcgatcccgccggggcgcgccatcagctgggtgttcggctgcccggccat
tacaacgtcgccaattgccttgtcgcactggctattctggacgcggtcggggtgtccccg
gagcaggcgtcgacgggcctgctacaggcccgcgtgccgggacgcatggaggagatcgac
gccggccaggacttcctggcgctggtcgactacgcccacaaaccgggcgcgttgcgcgcg
gtgctgaccacgctggcgcgtccggatcaccggctggccgtggtgttcggcgccggcggc
gaacgcgacccgggcaaacgggcgccgatgggcgcgacggcggccgagctggccgatctg
gtcgtcgtcaccgacgacaacccgcgcggtgaggacccggcgtcgattcgtcgcgaaatc
ctcgccggggcgaccgaaagcggttgtgcggcagacattgtcgagatcgccgaccgccgc
gacgcgatcaggcacgccgtcgcctgggcgggcccgggcgacgtcgtgctgatcgccggc
aagggccacgaaaccggccagagcgccggcgggcacacccgccccttcgacgaccgggtc
gaactggcgcaggcgctgcgggacctgaacggggcaccgcgatga

DBGET integrated database retrieval system