KEGG   Mycobacterium intracellulare MOTT-02: OCO_26870Help
Entry
OCO_26870         CDS       T01754                                 

Definition
adhA_1
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OCO_26870
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_26870
  Lipid metabolism
   00071 Fatty acid degradation
    OCO_26870
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCO_26870
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OCO_26870
   00626 Naphthalene degradation
    OCO_26870
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OCO_26870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2807160..2808188)
Genome map
AA seq 342 aa AA seqDB search
MASPVTTTAMRAWRVRRPGPMDTGPLEQVTTEVPRPGPSELLVAVRACGVCRTDLHVTEG
DLPVHRERVTPGHEVVGEVVELGAEAGDEFRVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRSLLRAELPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGARARELALELGAASAQGAADPPPAPLDAAI
LFAPVGDLVLPALQALDRGGTLAIAGIHLSDIPALNYQRHLFQERQVRSVTSNTRADARA
FLDFAGEHHIEVTTPEYPLGQADRALTDLSAGRIAGAAVLLV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccggtgaccaccacggcaatgcgcgcctggcgcgttcgtcgacccgggccg
atggataccggcccgctcgagcaggtcaccaccgaggtgccgcggccgggtccgtccgaa
ctgctggtggccgtgcgagcgtgcggggtgtgccggaccgacctgcacgtcaccgaaggc
gaccttcccgtccaccgcgagcgtgtcacgcccgggcacgaggtggtgggggaggtcgtc
gaactcggcgccgaggccggcgacgagttccgggtgggggaccgggtgggtatcgcctgg
ctgcgccacacctgtggcgtgtgcaagtactgccgccgcggcgacgagaacctctgcccg
aaatcccgctacaccggctgggacgccgacggcggctacgccgaattcgccaccgtcccg
gccgctttcgcgcaccccctgcccggcgggtacagcgacagcgaactcgcaccgttgttg
tgcgcgggcatcatcggttaccgctcgctgcttcgcgccgagctgccgcccggcgggcgg
ctgggcctctacggtttcggcggcagcgcgcacatcaccgcgcaggtcgccctcgcgcag
ggcgcagaggtgcacgtgatgacccgcggagcgcgggcccgcgagctggcgttggaactc
ggcgccgcatccgcacaaggcgcggcggatccgcccccggcgccactggacgccgcgatc
ctgttcgctcccgtcggtgatctggtgctgcccgcgctgcaggcgctggatcgcggtggc
acgctggcgatcgccgggatccacctctcggatatcccggcgctgaactaccagcgtcac
ctgtttcaggaacgccaggtccggtcggtcacctccaacacccgggccgacgcgcgggcc
ttcctcgatttcgcgggcgagcaccacatcgaggtgaccacgcccgaatatcctctcgga
caagccgatcgggcgttgacggatctgagcgccgggcgcatcgcgggcgcggcggtgctg
ctggtgtga

DBGET integrated database retrieval system