KEGG   Mycobacterium intracellulare MOTT-02: OCO_26870Help
Entry
OCO_26870         CDS       T01754                                 

Definition
adhA_1
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mit01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mit00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mit00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mit00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mit00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:mit00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2807160..2808188)
Genome map
AA seq 342 aa AA seqDB search
MASPVTTTAMRAWRVRRPGPMDTGPLEQVTTEVPRPGPSELLVAVRACGVCRTDLHVTEG
DLPVHRERVTPGHEVVGEVVELGAEAGDEFRVGDRVGIAWLRHTCGVCKYCRRGDENLCP
KSRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRSLLRAELPPGGR
LGLYGFGGSAHITAQVALAQGAEVHVMTRGARARELALELGAASAQGAADPPPAPLDAAI
LFAPVGDLVLPALQALDRGGTLAIAGIHLSDIPALNYQRHLFQERQVRSVTSNTRADARA
FLDFAGEHHIEVTTPEYPLGQADRALTDLSAGRIAGAAVLLV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccggtgaccaccacggcaatgcgcgcctggcgcgttcgtcgacccgggccg
atggataccggcccgctcgagcaggtcaccaccgaggtgccgcggccgggtccgtccgaa
ctgctggtggccgtgcgagcgtgcggggtgtgccggaccgacctgcacgtcaccgaaggc
gaccttcccgtccaccgcgagcgtgtcacgcccgggcacgaggtggtgggggaggtcgtc
gaactcggcgccgaggccggcgacgagttccgggtgggggaccgggtgggtatcgcctgg
ctgcgccacacctgtggcgtgtgcaagtactgccgccgcggcgacgagaacctctgcccg
aaatcccgctacaccggctgggacgccgacggcggctacgccgaattcgccaccgtcccg
gccgctttcgcgcaccccctgcccggcgggtacagcgacagcgaactcgcaccgttgttg
tgcgcgggcatcatcggttaccgctcgctgcttcgcgccgagctgccgcccggcgggcgg
ctgggcctctacggtttcggcggcagcgcgcacatcaccgcgcaggtcgccctcgcgcag
ggcgcagaggtgcacgtgatgacccgcggagcgcgggcccgcgagctggcgttggaactc
ggcgccgcatccgcacaaggcgcggcggatccgcccccggcgccactggacgccgcgatc
ctgttcgctcccgtcggtgatctggtgctgcccgcgctgcaggcgctggatcgcggtggc
acgctggcgatcgccgggatccacctctcggatatcccggcgctgaactaccagcgtcac
ctgtttcaggaacgccaggtccggtcggtcacctccaacacccgggccgacgcgcgggcc
ttcctcgatttcgcgggcgagcaccacatcgaggtgaccacgcccgaatatcctctcgga
caagccgatcgggcgttgacggatctgagcgccgggcgcatcgcgggcgcggcggtgctg
ctggtgtga

DBGET integrated database retrieval system