KEGG   Mycobacterium intracellulare MOTT-02: OCO_27660Help
Entry
OCO_27660         CDS       T01754                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OCO_27660
Enzymes [BR:mit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     OCO_27660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2891250..2893433
Genome map
AA seq 727 aa AA seqDB search
MTELAPSLIELARRYGIATEYEDWSGRRVRVSEATLKAVLAALGVAAGDEQERNLALTAK
LRSHWARRLPATIVGRTGEQIRFWAHVTHGAPAEVWLALEDGTVRGDVAQVDNFTPPFDL
DGRWVGEASFLLPTDLPLGYHRVHLRSGDSETSTALIVTPDWLGLPERLGNRRAWGLAVQ
LYSVRSRGSWGVGDLTDLTDLAVWSASRHGADYLLVNPLHAAAPPGPKGRMEPSPYLPTS
RRFVNPIYLRVEAIPEFADLGKRSRVRRLRADVQERAGRVDTIDRDSSWAAKRAALKLLH
EEPRSAGRELSYAAFRDREGRALDDFATWCALAEQYGDDWHRWPEALQHPDASGVADFVE
KHSDTVDFHRWLQWQIDEQLAAAQSQAIRAGMSLGIMGDLAVGVHPNGADTWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGAPPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAGDHVRLRDSLGLLTRP
VAEELESDRAELAAWLAELRRVGLLDEGEDDPQQVVLALYKYLGRTPSRLLGLALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRDVLLEDVFTDPRAATLAEAVRAAIAPAASESSE
SVQSAAR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaactcgcaccgtcgctgatcgaactcgcccggaggtacggcatcgcgacggag
tacgaggactggagcggcaggcgggtgcgggtgtctgaggcgacgctcaaggccgtgctg
gccgcgctcggcgtcgcggccggcgacgaacaggaacgcaacctcgcgctcaccgccaag
ctgaggtcgcactgggcgcggcgactgccggcgaccatcgtcggccgcaccggtgagcag
atccggttttgggcccacgtcacccacggtgctcccgccgaggtgtggttggcgctcgag
gacggcacggtgcgcggcgacgtcgcgcaggtcgacaacttcaccccgccgttcgacctg
gacggacgctgggtcggcgaggccagcttcctgctgcccaccgacctgccgctggggtat
caccgggtgcacctgcggtccggggactccgagaccagcaccgcgctgatcgtgacgccg
gattggctcgggctgccggagcggctcggcaaccgtcgcgcctggggcctggcggttcag
ctctacagcgtgcggtcccgggggtcctggggcgtcggggatctcaccgatctgaccgac
ctcgcggtgtggtcggcgtcgcgccacggcgccgattacctcctggtcaatccgctgcat
gcggcggcgcctccgggtccgaagggccggatggagccgtcgccgtacctgccgacgtcg
cggcgcttcgtcaatccgatttatcttcgcgtcgaggcgatccccgaattcgccgacctg
ggcaagcgcagccgggtccgccggctgcgcgcggacgtccaggagcgcgccggccgcgtc
gacaccatcgaccgcgacagctcgtgggcggccaaacgggccgccctcaagctgctgcac
gaggaaccgcggtcggcgggccgggaactgtcctacgcggcgttccgcgaccgggagggc
cgcgcactcgacgacttcgcgacctggtgcgcgctggccgaacaatacggcgatgactgg
catcgttggcccgaagcgctgcaacatcccgacgcgtccggggtcgcagactttgtcgaa
aaacattccgacaccgtcgatttccaccgctggttgcaatggcaaatcgacgagcagctc
gccgcggcccagtcccaggcgatccgggccggaatgtcgttgggcatcatgggcgacctg
gccgtcggcgtgcaccccaacggcgccgacacctgggcgctgcaggatgtgatggcgctg
ggcgtgaccgccggggcgccaccggacgagttcaatcagctcggccaggactggtcgcag
ccgccgtggcggccggaccgactggacgagcacgagtaccggccgtttcgcgcgttgatc
cgcgcggtactgcggcacgccggcggggtgcgcatcgaccacatcatcgggttgttccgg
ctctggtggatcccgcggggtgcaccaccaaccgagggcacctacgtccgctacgaccac
gaagccatgatcggcatcgtcgccctggaggcacaccgggccggcgcggtggtggtgggc
gaggacctcggcacggtcgagccgtgggtgcgtgactacctgttgttgcgggggctgctg
ggcacgtcgatcctctggttcgagctggaccgcgacgggaacggcggaccactgccggcg
gagcgctggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgacggcc
ggctacctggcgggcgaccatgtgcggctgcgtgactcgctgggattgctgacccggccc
gtcgccgaggagctcgagtccgaccgtgccgagttggcggcgtggctggccgagttgcgc
cgggtggggctgctcgatgaaggcgaagacgacccgcagcaggtcgtcctggcgctgtac
aagtacctgggccggacgccgtcgcggctgctggggctggcgctcaccgacgccgtcggt
gaccgtcgcacccagaaccagcccggcactacggacgaataccccaactggcgggtcccg
ctgaccggtccggacgggcgcgacgtgctgctcgaagacgtgttcaccgacccccgggcc
gccacgctggccgaggccgtgcgcgccgcgatcgccccggccgcctcggaaagctcggag
agcgttcaaagcgcggcccgctga

DBGET integrated database retrieval system