KEGG   Mycobacterium intracellulare MOTT-02: OCO_29110Help
Entry
OCO_29110         CDS       T01754                                 

Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    OCO_29110
Enzymes [BR:mit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     OCO_29110
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   OCO_29110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3071483..3072232
Genome map
AA seq 249 aa AA seqDB search
MDLKRRIPLLRWSVWRMVVGNRNITTTGQIGDGREAAAVEYVLRNARAGDVDDVLTTIDK
FAYEKSMLINVGDEKGLLLDAAVRRADPALALELGTYCGYGALRIARAAPKAKVFSVELA
EANAANARQIWAHAGVADRVTCVVGTIGDGGRTLDALAEHGFAAGALDFVFLDHDKDAYL
DDLKSILDRGWLHPGSIVVADNVRVPGAPKYRGYMHRHQGTRWNTVEHKTHLEYQSLVSD
LVLESEFLG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggatctcaagcgacggatacccctgctgcggtggtcggtctggcggatggtcgtcggg
aatcgcaacatcaccacgacgggccagatcggcgacgggcgcgaagccgccgccgtcgaa
tacgtgctgcggaacgcccgggccggcgacgtcgacgacgtgctgacgaccatcgacaag
ttcgcctacgagaagtcgatgttgatcaacgtcggcgacgagaagggactgctgctcgac
gccgcggtgcggcgcgccgatccggcgctggcgctcgaattgggcacctactgcggctac
ggcgcgctgcgcatcgcccgggccgcgccgaaggccaaggtgttctcggtcgaactcgcc
gaggccaacgccgccaacgcccgccagatctgggcgcatgccggcgtggccgaccgtgtg
acgtgtgtggtcggcaccatcggcgacggcggccgcaccctggatgcgctggccgaacac
gggtttgccgctggcgcactcgatttcgtgttcctcgatcacgacaaggacgcctacctc
gacgacctgaagagcatcctggatcggggctggctgcatccgggctcgatcgtggtcgcc
gacaatgtgcgggtgccgggcgcaccgaagtaccgcgggtacatgcaccggcatcagggc
acgcggtggaacaccgtcgagcacaagacccacctcgagtaccaatcgttggtgtccgac
ctggtgctggagtccgaattcctgggctga

DBGET integrated database retrieval system