KEGG   Mycobacterium intracellulare MOTT-02: OCO_29880Help
Entry
OCO_29880         CDS       T01754                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mit00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCO_29880
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    OCO_29880
Enzymes [BR:mit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     OCO_29880
Two-component system [BR:mit02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   OCO_29880
Bacterial motility proteins [BR:mit02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    OCO_29880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3172874..3173515
Genome map
AA seq 213 aa AA seqDB search
MSATQHKPVQAAFGRVVLVASLGGMKALGTVLAGLPGDFAVPVVVAQHRRPTLSGDDPLA
QILSRASSLPIRVAEPGAPADKPGITIVPAGKTATIDADGAWMLAEEAAKASVGDAVLTS
SAALVPTVAVILTGRLADGANGCRAVKRNGGRVLVQDPATAEASSMPAHAIATGCVDFVL
PPDRLAAAVLALTTAPGGAELLTVPVPPWACLN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgacccaacacaagcccgtccaggcggcgtttgggcgagtggtgctggtggcg
tcgctgggcggcatgaaagccctgggcaccgtgctcgcgggtctgccgggtgattttgcg
gtacccgtcgtcgtcgcccagcatcgccgccccacgctcagcggcgacgatccgctggcc
cagattttgtcccgcgcgagctctctgccgattcgagtcgccgagccgggggcgccggcg
gacaaaccgggcatcaccatcgtgcccgccggaaagacggcaaccatcgatgcggacggc
gcctggatgctcgccgaggaagcggccaaggccagcgtcggggacgccgtcctgaccagc
tccgccgcgctggtgccgacggtcgccgtgatcctgaccgggcggctggccgacggcgcc
aacggatgtcgcgcggtcaagcgcaacggcgggcgcgtgctcgtccaagacccggcgacc
gccgaggcgtcgagcatgccggcgcacgcgatcgccaccggctgcgtggatttcgtgctg
ccgcccgatcgcctcgcggcggcggtgctcgccctgaccaccgcacccgggggcgccgaa
ctgctgacggttcccgtgccgccgtgggcatgtcttaactag

DBGET integrated database retrieval system