KEGG   Mycobacterium intracellulare MOTT-02: OCO_29910Help
Entry
OCO_29910         CDS       T01754                                 

Definition
formamidopyrimidine DNA-glyxosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mit03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3175402..3176187
Genome map
AA seq 261 aa AA seqDB search
MPELPDVEGFRRQLAATLPRRRIRHVQVHDPGILRNTTGQALARRLTGHRFAGPRRHGKW
LVLPTDGPALLIHSGMTGRPYYAPDGAAHDPYERLVVSLDGGELRYADLRKLRGVWLADD
ADDIGHITGPQGPDALGLGLREFRAVLASRSARSRQLKPTLMDQSVLAGLGNLLVDEICW
RAKTRPTVAVADLGDDDVKALHAAMTRVLRTAVRHGRVPGLPRWLTRVRDEPDPRCPRCG
TRLERARVGGRATLWCPRCQP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctgcccgacgtggaagggtttcggcggcaactggccgcgaccctgccgcgg
cggcgaatccggcacgtgcaggtgcacgatcccgggatcctgcgcaacaccaccggacaa
gcgctggcgcgccggttgaccggtcaccgcttcgccggcccacgccggcacggcaagtgg
ttggtgctccccaccgacggcccggcgctgctgatccacagcggcatgaccggccggccc
tactatgcccccgacggggccgcccacgacccctacgagcggctggtggtgtcgctggac
gggggcgagctgcgctacgccgacctccgcaaattgcgcggggtgtggctggccgacgat
gccgacgacatcgggcacatcaccggcccgcagggacccgacgcgctgggtctcggcctg
cgcgagttccgcgcggtgctggcctcgcggtcggcccgctcgcggcagctcaaacccacg
ctgatggaccagtcggtgctcgccggcctcggcaacctgctggtcgacgagatctgttgg
cgggccaaaacccgaccgaccgtggcggtcgcggacttgggcgacgacgacgtaaaggcc
ttgcacgccgcgatgacccgggtgctgcgcaccgcggtgcgccacggccgggtgcccggc
ctgccgcgctggctcaccagggtgcgtgacgagcccgacccgcgctgcccccgctgtggg
acgcggctcgagcgcgcccgggtgggcggaagggcgacgctgtggtgtccgcgctgccag
ccgtag

DBGET integrated database retrieval system