KEGG   Mycobacterium intracellulare MOTT-02: OCO_30290Help
Entry
OCO_30290         CDS       T01754                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OCO_30290
  Amino acid metabolism
   00340 Histidine metabolism
    OCO_30290
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     OCO_30290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3214516..3215919)
Genome map
AA seq 467 aa AA seqDB search
MDTVSTIRPSPMARIDLRGAELTAARLRAALPRGGADVEAVLPKVRPIVQAVAERGAEAA
LEFGESFDGVRPPAVRVPAEALEKALAELDAAVAEALRVMIERTRAVHADQRRTDVTTTL
GPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLVVASPPQAQFGGLP
HPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRARSASSPGADAELA
PVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADNTADPAHVAADMISQAEHDE
MAGSVLVTPSEDLAAATDKELAAQLRTTVHRERVTAALGGRQSAIILVDDVDAGVKVVNA
YAAEHLEIQTADAASVAGRIRAAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVITLAEAEDLPAHGEAVRRRFER
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgtgagcaccatccgaccgtcgccgatggcccgtatcgacctgcggggcgcg
gaattgacggctgcccgtttgcgggcggcgctgccgcgtggcggtgccgacgtggaggcg
gtgctgcccaaggtgcgcccgatcgtgcaggccgtcgcggagcgcggcgccgaggccgcc
ctcgaattcggggagtccttcgacggggtgcggcccccggccgtccgggtgcccgcggag
gcgctcgagaaagccctggccgaactggacgcggcggtcgccgaggccctgcgcgtgatg
atcgagcgcacccgcgcggtgcacgccgaccagcgccgcaccgacgtgacgacgacgctc
ggcccgggcgcgacggtcaccgagcggtgggtaccggtcgagcgggtgggcctctacgtg
cccggcggcaacgccgtctacccgtccagcgtcgtgatgaacgtggtgccggcgcaggcc
gccggcgtcgcctcgctggtggtggccagcccgccgcaggcccagttcggcggcctgccg
cacccgaccatcctggcagcggcccggctgctgggcgtcgacgaggtgtgggccgtcggc
ggggcgcaggccgtcgcgctgctggcctacggcggcaccgataccggggccgaatggccc
ggcttctcgtcggatcgcgcacgatccgcatcgtcgccgggggcagacgccgagttggcg
cccgtcgacatgatcaccgggccgggcaacatctacgtcaccgccgccaagcggctgtgc
cgttcgcgggtcggcatcgacgccgaggccgggccgacggagatcgcgatcctggccgat
aacaccgccgaccccgcgcacgtggccgccgacatgatcagccaggccgaacacgacgag
atggccggcagcgtgctggtgacccccagcgaggacctggccgcggccaccgacaaggaa
ctggccgcccagttgcggacgaccgtgcaccgcgagcgggtgaccgccgccctgggcggg
cgtcagtcggcgatcatcctggtcgacgacgtggacgccggcgtcaaggtcgtcaacgcc
tacgccgccgaacacctggagatccagaccgccgacgcggcgagcgtggccgggcgaata
cgcgcggcgggagccattttcgtcggcccgtatgcgccggtgagcctcggggactactgc
gccggatccaatcacgtcctgccgaccgccggctgcgcgcggcattccagcggcctgtcc
gtgcagaccttcctgcgcggcatccacgtcgtcgactacaccgaggcggcgctcaaagac
gtgtccgggcacgtgatcacgctcgccgaggccgaggacctgccggcgcacggcgaggcg
gtacggcggaggttcgagcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system