KEGG   Mycobacterium intracellulare MOTT-02: OCO_31920Help
Entry
OCO_31920         CDS       T01754                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OCO_31920
   01230 Biosynthesis of amino acids
    OCO_31920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_31920
   00051 Fructose and mannose metabolism
    OCO_31920
   00562 Inositol phosphate metabolism
    OCO_31920
Enzymes [BR:mit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCO_31920
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCO_31920
  Exosomal proteins of bladder cancer cells
   OCO_31920
  Exosomal proteins of melanoma cells
   OCO_31920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3438876..3439661)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDAGAYTGEISGAFLAKLGCTFVVVGHSERRTYHHEDDAVVAAKTAA
ALKHELTPIVCIGEHLEVREAGNHVIHCEEQLRGSLAGLSTEQIGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctgacctacggcgggcaggacctgtcccagcacgacgccggcgcctacacc
ggcgagatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tccgagcgcaggacctaccaccacgaggacgacgccgtcgtcgccgccaagaccgccgcg
gcgctcaagcacgaactgaccccgatcgtctgcatcggcgagcacctcgaggtgcgcgag
gccggaaaccacgtcatccactgcgaagagcagctgcgggggtcgctggccgggctgtcc
accgaacagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgcgcggcgatccgcaaggagttggcg
tcgctcgcctcgccccaggtcgccgactcggtgcgggtgctctacggcggctcggtcaac
gccaagaacgtcggcgagctcgtcgcccaggacgacatcgacggcggcctggtcggcggc
gcgtcgctggacggcgagcaattcgccacgctggcggccatcgccgccggtgggcctctt
ccgtga

DBGET integrated database retrieval system