KEGG   Mycobacterium intracellulare MOTT-02: OCO_31920Help
Entry
OCO_31920         CDS       T01754                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00010  Glycolysis / Gluconeogenesis
mit00051  Fructose and mannose metabolism
mit00562  Inositol phosphate metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
mit01230  Biosynthesis of amino acids
Module
mit_M00002  Glycolysis, core module involving three-carbon compounds
mit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_31920
   00051 Fructose and mannose metabolism
    OCO_31920
   00562 Inositol phosphate metabolism
    OCO_31920
Enzymes [BR:mit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     OCO_31920
Exosome [BR:mit04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   OCO_31920
  Exosomal proteins of bladder cancer cells
   OCO_31920
  Exosomal proteins of melanoma cells
   OCO_31920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFC49555
Position
complement(3438876..3439661)
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLTYGGQDLSQHDAGAYTGEISGAFLAKLGCTFVVVGHSERRTYHHEDDAVVAAKTAA
ALKHELTPIVCIGEHLEVREAGNHVIHCEEQLRGSLAGLSTEQIGKVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccactgatcgccggcaactggaagatgaacctcaaccacttcgaggcg
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtcgac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctgacctacggcgggcaggacctgtcccagcacgacgccggcgcctacacc
ggcgagatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tccgagcgcaggacctaccaccacgaggacgacgccgtcgtcgccgccaagaccgccgcg
gcgctcaagcacgaactgaccccgatcgtctgcatcggcgagcacctcgaggtgcgcgag
gccggaaaccacgtcatccactgcgaagagcagctgcgggggtcgctggccgggctgtcc
accgaacagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgcgcggcgatccgcaaggagttggcg
tcgctcgcctcgccccaggtcgccgactcggtgcgggtgctctacggcggctcggtcaac
gccaagaacgtcggcgagctcgtcgcccaggacgacatcgacggcggcctggtcggcggc
gcgtcgctggacggcgagcaattcgccacgctggcggccatcgccgccggtgggcctctt
ccgtga

DBGET integrated database retrieval system