KEGG   Mycobacterium intracellulare MOTT-02: OCO_33120Help
Entry
OCO_33120         CDS       T01754                                 

Definition
holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OCO_33120
Enzymes [BR:mit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OCO_33120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3566433..3567032)
Genome map
AA seq 199 aa AA seqDB search
MIAAVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTEARLITAMIVREDSMTLY
GFTDTDTRDLFLTLLSVSGVGPRLAMATLAVHDAGALRQALHDGDVAALTRVPGIGKRSA
ERMVLELRDKVGAAGAGAAPAGAALNGHAVRGPVIEALVGLGFAVKQAEEATDKVLAAEQ
DATTSGALRAALSLLGKSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcggtgcgcggcgaggtgctcgaggtggcgctcgaccatgcggtgatcgag
gccgccggcgtcggctaccgggtgaacgcgacgccgtcgacgctgtccacgctgcggacc
gggaccgaggcgcggctgatcaccgcgatgatcgtccgcgaggattcgatgacgctgtac
ggcttcaccgacaccgacacccgcgacctgtttttgaccctgctgtcggtgtcgggggtc
gggccccggctggcgatggcgaccctggccgtgcacgacgccggcgcgctgcgccaggcg
ctgcacgacggcgacgtcgccgcgctgacccgggtgcccgggatcggcaaacgcagcgcc
gaacggatggtcctggagctgcgggacaaggtgggcgccgccggtgcgggcgcggccccc
gcgggcgccgcgctcaacggccacgcggtccgcgggccggtgatcgaggccctggtgggc
ctcgggttcgccgtcaagcaggccgaggaagccaccgacaaggtgctggccgccgagcag
gacgcgaccacctccggtgcgctgcgcgccgccctgtcgctgctgggcaagtcccgatga

DBGET integrated database retrieval system