KEGG   Mycobacterium intracellulare MOTT-02: OCO_34030Help
Entry
OCO_34030         CDS       T01754                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    OCO_34030
Enzymes [BR:mit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     OCO_34030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3640209..3641585)
Genome map
AA seq 458 aa AA seqDB search
MTSRSYCVVGGGISGLTAAYRLRMSLGDDAAITLFDPGERLGGILRTELVGGAPMDLGAE
AFVLRRPELPALLVELNLTGRQLVSTGARPLIYSGQRLRPLPTGTVVGIPSSAASVAGLV
DEATVARIDAEPSRHLEWVAGSDPAVADLVGDRFGDQVVARSVDPLLSGVYAGSAATIGL
RAAAPTVAAALDRGAASLTDAVGRALPPATGAPVFGALDGGYRVLVEELAARAQPRWVRA
AASRLERADAGWAVFDDTGARWLADAVILAVPVHESCRLLGGIAPRSVAAAGHIASASSV
VLALAVPADTAFPDCSGVLVATGERLRAKAITLSSRKWGARADVQLLRLSFGRFGDHVAA
STSDDELLAWALGDVATVFGLDVDPVDVRMQRWIDAMPQYGPGHADLVAEVRAGLPPTLA
VAGSYLDGIGVPACVGAAGRAAEDVIRAIGGPDPEVAR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcccgctcgtattgcgttgtcgggggcgggatttcggggctgacggcggcctac
cggctgcgcatgtccctcggcgacgacgcggccatcacgctgttcgacccgggggagcgg
ctcggcgggatcctgcgcaccgagctggtcggcggggcgccgatggatctgggcgccgag
gcgttcgtgctgcgccggcccgagctgccggcgctgctggtcgagctgaatctgactggg
cgccaactggtttcgaccggtgcccgcccgctgatctacagcgggcaacggctgcgcccg
ctgcccaccggcacggtcgtgggcatcccgtcgtcggcggcgtcggtggccggattggtc
gacgaggcgaccgtcgcccgcatcgacgccgaaccctcccgccacttggagtgggtcgcc
ggcagcgatcccgcggtggccgacctggtgggcgaccggttcggcgaccaggtggtcgcg
cggtcggtggacccgctgctgagcggggtctacgcgggctcggcggccactatcggcctg
cgggcggccgcgccgaccgtggccgcggcgctggaccgtggcgccgccagcctgaccgac
gccgtcgggcgggccctgccgccggccaccggcgcgccggtgttcggcgcgctcgacggc
gggtaccgggtgctggtcgaggagctcgccgcgcgcgcccagccgcgctgggtgcgcgcc
gccgcgtcgcggctcgagcgcgccgacgcgggctgggcggtgttcgacgacaccggcgca
cgctggctcgccgacgcggtgatcctggccgtgcccgtgcacgaatcgtgccgcctgctc
ggcggcatcgcgccccgcagcgtcgccgcggccgggcacatcgcgagcgcatcgtcggtg
gtgctggcgctggcagtgccggctgacaccgcgttccccgactgctcgggcgtgctggtg
gccaccggggagcggttgcgggccaaggccatcacgctgtcgtcccgcaagtggggtgcc
cgggccgacgtgcagctgctgcggttgtcgttcgggcggttcggcgaccacgtggcggcc
agcacctccgacgacgagctgctggcctgggcgctgggggatgtggccaccgtgttcggg
ctcgacgtcgaccccgtcgacgtccgaatgcagcgctggatcgacgccatgccacagtac
ggccccggccatgccgacctggtcgccgaggtgcgcgccggactgccgccgacgctcgcg
gtggcggggagctacctcgacggcatcggcgtgcccgcctgcgtcggcgcggccgggcgc
gcggccgaggatgtgatcagggccatcggaggcccggacccggaagtggcacgatag

DBGET integrated database retrieval system