KEGG   Mycobacterium intracellulare MOTT-02: OCO_34240Help
Entry
OCO_34240         CDS       T01754                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
mit  Mycobacterium intracellulare MOTT-02
Pathway
mit00010  Glycolysis / Gluconeogenesis
mit00520  Amino sugar and nucleotide sugar metabolism
mit01100  Metabolic pathways
mit01110  Biosynthesis of secondary metabolites
mit01120  Microbial metabolism in diverse environments
mit01130  Biosynthesis of antibiotics
mit01200  Carbon metabolism
Module
mit_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OCO_34240
   00520 Amino sugar and nucleotide sugar metabolism
    OCO_34240
Enzymes [BR:mit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     OCO_34240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFC49787
Position
3660004..3660813
Genome map
AA seq 269 aa AA seqDB search
MTSTDSTTDTPGTAPADGTHERRGFGIDVGGSGIKGGIVDMDTGLLIGERVKLLTPQPAT
PSAVAKTIAAVVNEFGWTGPLGVTYPGVVTHGVVQTAANVDKSWIGVNARDIISAELDGQ
DVTVLNDADAAGLAEEHYGAGRNQTGLVILLTFGTGIGSAVIHNGTLIPNTEFGHLEVGG
KEAEKQAASSVKEKKGWSYEKWTKHVTEVLVSIENAMWPDLFIAGGGISRKADKWLPLLE
NRTPVVAAALLNTAGIVGAAMAATSDVTH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgactcgaccacggacacgcccggcaccgcaccggccgacggcacacat
gaacgccgcggcttcggcatcgacgtcggcggcagcggcatcaagggcggcatcgtcgac
atggacacggggttgttgatcggcgaacgggtcaaactgctgaccccgcaacccgcgacg
ccgtcggcggtcgccaagaccatcgccgcggtcgtcaacgaattcggatggaccgggccc
ctcggcgtgacctaccccggggtggtcacgcacggcgtggtgcagaccgccgccaacgtg
gacaagtcctggatcggggtcaacgcccgcgacatcatcagcgccgagctggacggacag
gacgtgacggtcctcaacgatgccgacgcggccgggctggccgaggagcactacggggcg
ggcaggaatcagaccggcctggtgattctcttgacgttcggcaccggcatcggctcggcg
gtcatccacaacggcacgctgatccccaacaccgaattcgggcacctggaggtcggcggc
aaggaagccgagaaacaagccgcctcctcggtgaaggaaaagaagggctggtcctacgaa
aaatggaccaaacacgtcaccgaggtgctggtgagcatcgagaacgcgatgtggccggac
ctgttcatcgccggaggcgggatcagccgcaaggccgacaagtggctgccgctgctcgaa
aaccgcaccccggtggtggccgcggccctgctcaacacggccgggatcgtcggcgcggcg
atggccgccacctcggacgtgacccactga

DBGET integrated database retrieval system